GRK6 Antibody

Contact us
Catalog number: R32102
Price: 406 €
Supplier: NJS poly
Product name: GRK6 Antibody
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GRK6
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the GRK6 antibody should be determined by the researcher
Intented use: This GRK6 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P43250
Purity: Antigen affinity
Description: Also, GRK6 appears to be involved in responses tomorphine, It is mapped to 5q35, Several transcript variants encoding different isoforms have been described for this gene, The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation, This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family, G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene
Immunogen: Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK6 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GRK6
Short name: GRK6 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: GRK6 (Antibody to)
Alternative technique: antibodies
Identity: 4545
Gene: GRK6 | More about : GRK6
Long gene name: G protein-coupled receptor kinase 6
Synonyms gene: GPRK6
Locus: 5q35, 3
Discovery year: 1994-03-29
Entrez gene record: 2870
Pubmed identfication: 8415712
RefSeq identity: NM_002082
Havana BLAST/BLAT: OTTHUMG00000163401

Related Products :