| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GRK3 / ADRBK2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the GRK3 antibody should be determined by the researcher |
| Intented use: |
This GRK3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P35626 |
| Purity: |
Antigen affinity |
| Description: |
Overall, The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors, The human ADRBK2 gene is located on 22q11, These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function, also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity, Beta-adrenergic receptor kinase 2 (beta-ARK-2) |
| Immunogen: |
Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GRK3 / ADRBK2 |
| Short name: |
GRK3 Antibody / ADRBK2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GRK3 (Antibody to) / ADRBK2 |
| Alternative technique: |
antibodies |
| Identity: |
290 |
| Gene: |
GRK3 |
More about : GRK3 |
| Long gene name: |
G protein-coupled receptor kinase 3 |
| Synonyms gene: |
ADRBK2 |
| Synonyms gene name: |
adrenergic, beta, receptor kinase 2 |
| Synonyms: |
BARK2 |
| Locus: |
22q12, 1 |
| Discovery year: |
1992-03-25 |
| GenBank acession: |
X69117 |
| Entrez gene record: |
157 |
| Pubmed identfication: |
7695743 |
| RefSeq identity: |
NM_005160 |
| Classification: |
Pleckstrin homology domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000150280 |