GRK3 Antibody / ADRBK2

Contact us
Catalog number: R32079
Price: 406 €
Supplier: NJS poly
Product name: GRK3 Antibody / ADRBK2
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GRK3 / ADRBK2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the GRK3 antibody should be determined by the researcher
Intented use: This GRK3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P35626
Purity: Antigen affinity
Description: Overall, The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors, The human ADRBK2 gene is located on 22q11, These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function, also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity, Beta-adrenergic receptor kinase 2 (beta-ARK-2)
Immunogen: Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GRK3 / ADRBK2
Short name: GRK3 Antibody / ADRBK2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: GRK3 (Antibody to) / ADRBK2
Alternative technique: antibodies
Identity: 290
Gene: GRK3 | More about : GRK3
Long gene name: G protein-coupled receptor kinase 3
Synonyms gene: ADRBK2
Synonyms gene name: adrenergic, beta, receptor kinase 2
Synonyms: BARK2
Locus: 22q12, 1
Discovery year: 1992-03-25
GenBank acession: X69117
Entrez gene record: 157
Pubmed identfication: 7695743
RefSeq identity: NM_005160
Classification: Pleckstrin homology domain containing
Havana BLAST/BLAT: OTTHUMG00000150280

Related Products :