| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GRK5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the GRK5 antibody should be determined by the researcher |
| Intented use: |
This GRK5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P34947 |
| Purity: |
Antigen affinity |
| Description: |
It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs), The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation, This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family, G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene |
| Immunogen: |
Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GRK5 |
| Short name: |
GRK5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
G protein-coupled receptor kinase 5 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
GPRK5, GRK5 and IDBG-640359 and ENSBTAG00000007981 and 281801, GRK5 and IDBG-91131 and ENSG00000198873 and 2869, Grk5 and IDBG-181926 and ENSMUSG00000003228 and 14773, nuclei, this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004703 and G-protein coupled receptor kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005080 and protein kinase C binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005543 and phospholipid binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007188 and adenylate cyclase-modulating G-protein coupled receptor signaling pathway and biological process this GO :0007217 and tachykinin receptor signaling pathway and biological process this GO :0008277 and regulation of G-protein coupled receptor protein signaling pathway and biological process this GO :0016055 and Wnt signaling pathway and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004703 : G-protein coupled receptor kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005080 : protein kinase C binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005543 : phospholipid binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004703 : G-protein coupled receptor kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005080 : protein kinase C binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005543 : phospholipid binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0038032 and termination of G-protein coupled receptor signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0046777 and protein autophosphorylation and biological process, G protein-coupled receptor kinase 5 |
| Identity: |
4544 |
| Gene: |
GRK5 |
More about : GRK5 |
| Long gene name: |
G protein-coupled receptor kinase 5 |
| Synonyms gene: |
GPRK5 |
| Locus: |
10q26, 11 |
| Discovery year: |
1994-03-29 |
| GenBank acession: |
L15388 |
| Entrez gene record: |
2869 |
| Pubmed identfication: |
7685906 |
| RefSeq identity: |
NM_005308 |
| Havana BLAST/BLAT: |
OTTHUMG00000019149 |