| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AQP1 / Aquaporin 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher |
| Intented use: |
This Aquaporin 1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P29972 |
| Purity: |
Antigen affinity |
| Description: |
AQP1 is also expressed by the choroid plexus and various other tissues, It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient, Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules |
| Immunogen: |
Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Aquaporin 1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Membrane |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AQP1 / Aquaporin 1 |
| Short name: |
AQP1 Antibody / Aquaporin 1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Uncharacterized protein (Antibody to) / Aquaporin 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AQP1 and IDBG-407682 and ENSG00000250424 and, Plasma membranes, this GO :0005215 and transporter activity and molecular function this GO :0006810 and transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005215 : transporter activity, this GO :0005215 : transporter activity, transporter activity, Uncharacterized protein |
| Identity: |
633 |
| Gene: |
AQP1 |
More about : AQP1 |
| Long gene name: |
aquaporin 1 (Colton blood group) |
| Synonyms gene: |
CO |
| Synonyms gene name: |
28kDa, 28kDa) aquaporin 1 (channel-forming integral protein, CO blood group) aquaporin 1 , Colton blood group aquaporin 1 (channel-forming integral protein |
| Synonyms: |
CHIP28 |
| Locus: |
7p14, 3 |
| Discovery year: |
1993-07-09 |
| GenBank acession: |
M77829 |
| Entrez gene record: |
358 |
| Pubmed identfication: |
1722319 3166547 |
| RefSeq identity: |
NM_000385 |
| Classification: |
Aquaporins Blood group antigens |
| Havana BLAST/BLAT: |
OTTHUMG00000023944 |
| Locus Specific Databases: |
Blood Group Antigen Mutation Database LRG_808 |