AQP1 Antibody / Aquaporin 1

Contact us
Catalog number: R32050
Price: 745 €
Supplier: Biomatik ELISA kits
Product name: AQP1 Antibody / Aquaporin 1
Quantity: 1 plate of 96 wells
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AQP1 / Aquaporin 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher
Intented use: This Aquaporin 1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P29972
Purity: Antigen affinity
Description: AQP1 is also expressed by the choroid plexus and various other tissues, It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient, Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules
Immunogen: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Aquaporin 1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Membrane
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AQP1 / Aquaporin 1
Short name: AQP1 Antibody / Aquaporin 1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Uncharacterized protein (Antibody to) / Aquaporin 1
Alternative technique: antibodies
Alternative to gene target: AQP1 and IDBG-407682 and ENSG00000250424 and, Plasma membranes, this GO :0005215 and transporter activity and molecular function this GO :0006810 and transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005215 : transporter activity, this GO :0005215 : transporter activity, transporter activity, Uncharacterized protein
Identity: 633
Gene: AQP1 | More about : AQP1
Long gene name: aquaporin 1 (Colton blood group)
Synonyms gene: CO
Synonyms gene name: 28kDa, 28kDa) aquaporin 1 (channel-forming integral protein, CO blood group) aquaporin 1 , Colton blood group aquaporin 1 (channel-forming integral protein
Synonyms: CHIP28
Locus: 7p14, 3
Discovery year: 1993-07-09
GenBank acession: M77829
Entrez gene record: 358
Pubmed identfication: 1722319 3166547
RefSeq identity: NM_000385
Classification: Aquaporins Blood group antigens
Havana BLAST/BLAT: OTTHUMG00000023944
Locus Specific Databases: Blood Group Antigen Mutation Database LRG_808

Related Products :

AQP16-PAN-P AQP1-AQP6 control/blocking peptides (25 ug each of AQP1-6) 25 μg x6 333 € adi human
AQP0-9-AP-P AQP1-AQP9 and AQPAP control/blocking peptides (25 ug each of AQP1-9) 25 μg x10 1167 € adi human
AQP19-PAN-P AQP1-AQP9 control/blocking peptides (25 ug each of AQP1-9) 25 μg x9 405 € adi human
AQP16-PAN-S Rabbit Anti-AQP1-AQP6 (25 ul each of AQP1-6) neat serum 25 μL x 6 536 € adi human
AQP16-PAN-A Rabbit Anti-AQP1-AQP6 IgG (25 ug each of AQP1-6) aff pure 25 μL x 6 565 € adi human
AQP0-9-AP-A Rabbit Anti-AQP1-AQP9 and AQPAP, aff. pure (25 ug each of AQP1-9) 25 μL x10 1428 € adi human
AQP0-9-AP-S Rabbit Anti-AQP1-AQP9 and AQPAP Antiserum (25 ul each of AQP1-9) 25 μL x10 1283 € adi human
AQP19-PAN-S Rabbit Anti-AQP1-AQP9 Antiserum (25 ul each of AQP1-9) 25 μL x9 1058 € adi human
AQP19-PAN-A Rabbit Anti-AQP1-AQP9 IgG, aff pure (25 ug each of AQP1-9) 25 μg x9 1203 € adi human
SM1809P anti-Aquaporin-1 / AQP1 (249-269) Antibody 0,1 mg 1022 € acr human
BB-PA1010 anti-Aquaporin-1 / AQP1 Antibody 0,1 mg 471 € acr human
C14546-1 anti-Aquaporin-1 / AQP1 Antibody 50 Вµg 347 € acr human
C14546-2 anti-Aquaporin-1 / AQP1 Antibody 0,1 mg 500 € acr human
CPA3132-100ul anti-Aquaporin-1 / AQP1 Antibody 0,1 ml 442 € acr human
CPA3132-200ul anti-Aquaporin-1 / AQP1 Antibody 0,2 ml 688 € acr human
CPA3132-30ul anti-Aquaporin-1 / AQP1 Antibody 30 Вµl 326 € acr human
SM1810P anti-Aquaporin-1 / AQP1 Antibody 0,1 mg 1022 € acr human
AP09887PU-N anti-Aquaporin-1 / AQP1 (C-term amidated) Antibody 0,1 mg 659 € acr human
AP23362PU-N anti-Aquaporin-1 / AQP1 (C-term) Antibody 0,1 mg 543 € acr human
AP09887CP-N anti-Aquaporin-1 / AQP1 control peptide Antibody 0,25 mg 413 € acr human
GENTAUR-58bdcd323045e Anti- Aquaporin 1, Colton Blood Group (AQP1) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcd32abf43 Anti- Aquaporin 1, Colton Blood Group (AQP1) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd298d1368 Anti- Aquaporin 1, Colton Blood Group (AQP1) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd3fe56e1e Anti- Aquaporin 1, Colton Blood Group (AQP1) Antibody 100ug 520 € MBS Polyclonals human
F45994-0.08ML AQP1 Antibody (Aquaporin 1) 0.08 ml 199 € NJS poly human
R30178 AQP1 Antibody Aquaporin 1 0.1mg 389 € NJS poly human
R32050 AQP1 Antibody / Aquaporin 1 0.1mg 406 € NJS poly human
MBS248928 PAb (IgG) to Human AQP1 / Aquaporin 1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS247992 Anti-Human AQP1 / Aquaporin 1 200ul 597 € MBS Polyclonals_1 human
EKU02541 Aquaporin 1, Colton Blood Group (AQP1) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human