| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
5HT2A Receptor |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the 5HT2AR antibody should be determined by the researcher |
| Intented use: |
This 5HT2AR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P28223 |
| Purity: |
Antigen affinity |
| Description: |
(1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse, 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus, Later it came back to prominence because it was also found to be mediating, Sparkes et al, This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), This receptor was given importance first as the target of psychedelic drugs like LSD, although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex, at least partly, especially the atypical ones, the action of many antipsychotic drugs, The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR) |
| Immunogen: |
Amino acids KENKKPLQLILVNTIPALAYKSSQLQMGQKKN of human 5HT2A Receptor were used as the immunogen for the 5HT2AR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the 5HT2AR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
5HT2A Receptor |
| Short name: |
5HT2A Receptor Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
5HT2A Receptor (Antibody to) |
| Alternative technique: |
antibodies |