| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RPA70 / RPA1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the RPA1 antibody should be determined by the researcher |
| Intented use: |
This RPA1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P27694 |
| Purity: |
Antigen affinity |
| Description: |
32-kD (RPA2), It had been found that recombinant human RPA1, It is composed of 70-kD (RPA1), RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40, The RPA1 subunit is responsible for high-affinity ssDNA binding, This gene is mapped to chromosome 17p13, and 14-kD (RPA3) subunits, and recombination, but it could not substitute for the complete complex in SV40 DNA replication in vitro, exhibited ssDNA-binding activity comparable to that of the complete RPA complex, purified from bacteria, repair, suggesting an important functional role for the other subunits, 3, Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene |
| Immunogen: |
Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RPA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RPA70 / RPA1 |
| Short name: |
RPA70 Antibody / RPA1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RPA70 (Antibody to) / RPA1 |
| Alternative technique: |
antibodies |
| Identity: |
10289 |
| Gene: |
RPA1 |
More about : RPA1 |
| Long gene name: |
replication protein A1 |
| Synonyms gene name: |
70kDa , replication protein A1 (70kD) replication protein A1 |
| Synonyms: |
REPA1 RPA70 HSSB RF-A RP-A |
| Locus: |
17p13, 3 |
| Discovery year: |
1993-12-14 |
| GenBank acession: |
M63488 |
| Entrez gene record: |
6117 |
| Pubmed identfication: |
8454588 |
| RefSeq identity: |
NM_002945 |
| Classification: |
Nucleotide excision repair |
| Havana BLAST/BLAT: |
OTTHUMG00000090579 |