RPA70 Antibody / RPA1

Contact us
Catalog number: R32042
Price: 406 €
Supplier: NJS poly
Product name: RPA70 Antibody / RPA1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RPA70 / RPA1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the RPA1 antibody should be determined by the researcher
Intented use: This RPA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P27694
Purity: Antigen affinity
Description: 32-kD (RPA2), It had been found that recombinant human RPA1, It is composed of 70-kD (RPA1), RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40, The RPA1 subunit is responsible for high-affinity ssDNA binding, This gene is mapped to chromosome 17p13, and 14-kD (RPA3) subunits, and recombination, but it could not substitute for the complete complex in SV40 DNA replication in vitro, exhibited ssDNA-binding activity comparable to that of the complete RPA complex, purified from bacteria, repair, suggesting an important functional role for the other subunits, 3, Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene
Immunogen: Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RPA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RPA70 / RPA1
Short name: RPA70 Antibody / RPA1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RPA70 (Antibody to) / RPA1
Alternative technique: antibodies
Identity: 10289
Gene: RPA1 | More about : RPA1
Long gene name: replication protein A1
Synonyms gene name: 70kDa , replication protein A1 (70kD) replication protein A1
Synonyms: REPA1 RPA70 HSSB RF-A RP-A
Locus: 17p13, 3
Discovery year: 1993-12-14
GenBank acession: M63488
Entrez gene record: 6117
Pubmed identfication: 8454588
RefSeq identity: NM_002945
Classification: Nucleotide excision repair
Havana BLAST/BLAT: OTTHUMG00000090579

Related Products :