HuD Antibody / ELAVL4

Contact us
Catalog number: R32036
Price: 406 €
Supplier: NJS poly
Product name: HuD Antibody / ELAVL4
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HuD / ELAVL4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the HuD antibody should be determined by the researcher
Intented use: This HuD antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P26378
Purity: Antigen affinity
Description: Also, And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs, As a result of this interaction the, ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs, HuD is important in neurons during brain development and plasticity, The HuD/ELAVL4 protein is anRNA-binding protein, This human gene is located at 1p34 by in situ hybridization, half-life of the transcript is increased, is a protein that in humans is encoded by the ELAVL4 gene, otherwise known as ELAV-like protein 4 or PNEM, HuD
Immunogen: Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HuD antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HuD / ELAVL4
Short name: HuD Antibody / ELAVL4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HuD (Antibody to) / ELAVL4
Alternative technique: antibodies
Identity: 3315
Gene: ELAVL4 | More about : ELAVL4
Long gene name: ELAV like RNA binding protein 4
Synonyms gene: HUD
Synonyms gene name: Drosophila)-like 4 (Hu antigen D) ELAV (embryonic lethal, Drosophila)-like 4 ELAV like neuron-specific RNA binding protein 4 , ELAV (embryonic lethal, abnormal vision, abnormal vision
Synonyms: PNEM
Synonyms name: Hu antigen D
Locus: 1p33-p32, 3
Discovery year: 1993-07-12
GenBank acession: AY033998
Entrez gene record: 1996
Pubmed identfication: 8222755
RefSeq identity: NM_021952
Classification: RNA binding motif containing
Havana BLAST/BLAT: OTTHUMG00000007877

Related Products :