| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HuD / ELAVL4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HuD antibody should be determined by the researcher |
| Intented use: |
This HuD antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P26378 |
| Purity: |
Antigen affinity |
| Description: |
Also, And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs, As a result of this interaction the, ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs, HuD is important in neurons during brain development and plasticity, The HuD/ELAVL4 protein is anRNA-binding protein, This human gene is located at 1p34 by in situ hybridization, half-life of the transcript is increased, is a protein that in humans is encoded by the ELAVL4 gene, otherwise known as ELAV-like protein 4 or PNEM, HuD |
| Immunogen: |
Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HuD antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HuD / ELAVL4 |
| Short name: |
HuD Antibody / ELAVL4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HuD (Antibody to) / ELAVL4 |
| Alternative technique: |
antibodies |
| Identity: |
3315 |
| Gene: |
ELAVL4 |
More about : ELAVL4 |
| Long gene name: |
ELAV like RNA binding protein 4 |
| Synonyms gene: |
HUD |
| Synonyms gene name: |
Drosophila)-like 4 (Hu antigen D) ELAV (embryonic lethal, Drosophila)-like 4 ELAV like neuron-specific RNA binding protein 4 , ELAV (embryonic lethal, abnormal vision, abnormal vision |
| Synonyms: |
PNEM |
| Synonyms name: |
Hu antigen D |
| Locus: |
1p33-p32, 3 |
| Discovery year: |
1993-07-12 |
| GenBank acession: |
AY033998 |
| Entrez gene record: |
1996 |
| Pubmed identfication: |
8222755 |
| RefSeq identity: |
NM_021952 |
| Classification: |
RNA binding motif containing |
| Havana BLAST/BLAT: |
OTTHUMG00000007877 |