| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PAR1 / F2R / Thrombin Receptor |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Thrombin Receptor antibody should be determined by the researcher |
| Intented use: |
This Thrombin Receptor antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P25116 |
| Purity: |
Antigen affinity |
| Description: |
By fluorescence in situ hybridization, PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response, Proteolytic cleavage leads to the activation of the receptor, The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model, also known as the coagulation factor II (thrombin) receptor, confirming its presence as a single locus in the human genome, is a protein that in humans is encoded by the F2R gene, this gene is mapped to 5q13, Proteinase-activated receptor 1 (PAR-1) |
| Immunogen: |
Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Thrombin Receptor antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PAR1 / F2R / Thrombin Receptor |
| Short name: |
PAR1 Antibody / F2R / Thrombin Receptor |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PAR1 (Antibody to) / coagulation factor II (thrombin) receptor / Thrombin Receptor |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, CF2R and HTR and PAR-1 and PAR1 and TR, DNA-templated and biological process this GO :0045907 and positive regulation of vasoconstriction and biological process this GO :0045987 and positive regulation of smooth muscle contraction and biological process this GO :0046427 and positive regulation of JAK-STAT cascade and biological process this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0051209 and release of sequestered calcium ion into cytosol and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051482 and positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway and biological process this GO :0051928 and positive regulation of calcium ion transport and biological process this GO :0051930 and regulation of sensory perception of pain and biological process this GO :0060155 and platelet dense granule organization and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :1900134 and negative regulation of renin secretion into blood stream and biological process this GO :2000484 and positive regulation of interleukin-8 secretion and biological process this GO :2000778 and positive regulation of interleukin-6 secretion and biological process, Extracellular, F2R and IDBG-29671 and ENSG00000181104 and 2149, F2r and IDBG-174004 and ENSMUSG00000048376 and 14062, G-protein beta-subunit binding, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001965 and G-protein alpha-subunit binding and molecular function this GO :0002248 and connective tissue replacement involved in inflammatory response wound healing and biological process this GO :0003105 and negative regulation of glomerular filtration and biological process this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007200 and phospholipase C-activating G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007205 and protein kinase C-activating G-protein coupled receptor signaling pathway and biological process this GO :0007260 and tyrosine phosphorylation of STAT protein and biological process this GO :0007262 and STAT protein import into nucleus and biological process this GO :0007529 and establishment of synaptic specificity at neuromuscular junction and biological process this GO :0007596 and blood coagulation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009611 and response to wounding and biological process this GO :0009653 and anatomical structure morphogenesis and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0015057 and thrombin receptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016265 and death and biological process this GO :0030168 and platelet activation and biological process this GO :0030193 and regulation of blood coagulation and biological process this GO :0030194 and positive regulation of blood coagulation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031094 and platelet dense tubular network and cellular component this GO :0031594 and neuromuscular junction and cellular component this GO :0031681 and G-protein beta-subunit binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032651 and regulation of interleukin-1 beta production and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045211 and postsynaptic membrane and cellular component this GO :0045893 and positive regulation of transcription, this GO :0001965 : G-protein alpha-subunit binding, this GO :0001965 : G-protein alpha-subunit binding and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015057 : thrombin receptor activity and also this GO :0031681 : G-protein beta-subunit binding, this GO :0004930 : G-protein coupled receptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015057 : thrombin receptor activity, this GO :0031681 : G-protein beta-subunit binding, 69975 and IDBG-645158 and ENSBTAG00000020199 and 526585, coagulation factor II (thrombin) receptor |
| Identity: |
30089 |
| Gene: |
PWAR1 |
More about : PWAR1 |
| Long gene name: |
Prader Willi/Angelman region RNA 1 |
| Synonyms: |
PAR1 PAR-1 |
| Synonyms name: |
Prader Willi/Angelman region 1 |
| Locus: |
15q11, 2 |
| Discovery year: |
2013-06-14 |
| Entrez gene record: |
145624 |
| Pubmed identfication: |
7987392 9477342 |
| Classification: |
Long non-coding RNAs |
| Havana BLAST/BLAT: |
OTTHUMG00000176879 |