| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
IGFBP5 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
ELISA, WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the IGFBP5 antibody should be determined by the researcher |
| Intented use: |
This IGFBP5 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P24593 |
| Purity: |
Antigen affinity |
| Description: |
Additionally, IGFBP-5 is cleaved into inactive fragments, IGFBP-5 is expressed by fibroblasts, IGFBP-5 is protected from proteolysis and potentiates IGF activity, IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis, It has a strong affinity for hydroxyapatite, It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells, Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice, The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in two human breast cancer cell lines, When bound to extracellular matrix, allowing it to bind to bone cells, but when it is soluble, making it the predominant IGFBP found in bone extracts, myoblasts and osteoblasts, Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene |
| Immunogen: |
Amino acids QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER of human IGFBP5 were used as the immunogen for the IGFBP5 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IGFBP5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
IGFBP5 |
| Short name: |
IGFBP5 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
IGFBP5 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
5474 |
| Gene: |
IGFBP5 |
More about : IGFBP5 |
| Long gene name: |
insulin like growth factor binding protein 5 |
| Synonyms gene name: |
insulin-like growth factor binding protein 5 |
| Locus: |
2q35 |
| Discovery year: |
1991-07-09 |
| Entrez gene record: |
3488 |
| Pubmed identfication: |
7511611 |
| RefSeq identity: |
NM_000599 |
| Classification: |
Insulin like growth factor binding proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000133058 |