IGFBP5 Antibody

Contact us
Catalog number: R32028
Price: 50 €
Supplier: abbex
Product name: IGFBP5 Antibody
Quantity: inquire
Other quantities: 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: IGFBP5
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ELISA, WB
Recommended dilutions: 1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
Notes: Optimal dilution of the IGFBP5 antibody should be determined by the researcher
Intented use: This IGFBP5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P24593
Purity: Antigen affinity
Description: Additionally, IGFBP-5 is cleaved into inactive fragments, IGFBP-5 is expressed by fibroblasts, IGFBP-5 is protected from proteolysis and potentiates IGF activity, IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis, It has a strong affinity for hydroxyapatite, It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells, Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice, The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in two human breast cancer cell lines, When bound to extracellular matrix, allowing it to bind to bone cells, but when it is soluble, making it the predominant IGFBP found in bone extracts, myoblasts and osteoblasts, Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene
Immunogen: Amino acids QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER of human IGFBP5 were used as the immunogen for the IGFBP5 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IGFBP5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: IGFBP5
Short name: IGFBP5 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: IGFBP5 (Antibody to)
Alternative technique: antibodies
Identity: 5474
Gene: IGFBP5 | More about : IGFBP5
Long gene name: insulin like growth factor binding protein 5
Synonyms gene name: insulin-like growth factor binding protein 5
Locus: 2q35
Discovery year: 1991-07-09
Entrez gene record: 3488
Pubmed identfication: 7511611
RefSeq identity: NM_000599
Classification: Insulin like growth factor binding proteins
Havana BLAST/BLAT: OTTHUMG00000133058

Related Products :

AP01082PU-N anti-IGFBP5 Antibody 0,5 ml 761 € acr human
AP01139BT-N anti-IGFBP5 Antibody 50 Вµg 543 € acr human
AP01139BT-S anti-IGFBP5 Antibody 25 Вµg 384 € acr human
AP01139PU-N anti-IGFBP5 Antibody 0,1 mg 543 € acr human
AP01139PU-S anti-IGFBP5 Antibody 50 Вµg 384 € acr human
DM3561P anti-IGFBP5 Antibody 0,1 mg 688 € acr human
GENTAUR-58bdfdec2fd0a Anti- IGFBP5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfdeccc4d5 Anti- IGFBP5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be085d718a6 Anti- IGFBP5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be085dd2576 Anti- IGFBP5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be09204641b Anti- IGFBP5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0920a1b47 Anti- IGFBP5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be472c10242 Anti- IGFBP5 Antibody 100ug 393 € MBS Polyclonals human
GT15183-100 anti-IGFBP5 Antibody 0,1 mg 703 € acr human
MO15091-500 anti-IGFBP5 Antibody 0,5 mg 645 € acr human
PA522 anti-IGFBP5 Antibody 5 Вµg 253 € acr human
PA522X anti-IGFBP5 Antibody 25 Вµg 384 € acr human
GENTAUR-58bdc2d18c926 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc2d2227b5 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc3ee10b76 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc4165e0f4 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc416b64f6 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc758f2506 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcd0a74cc5 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcd0adebb1 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcf15921a3 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd443e1098 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd9281ed74 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdda8a78842 Anti- Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody 100ug 564 € MBS Polyclonals human
abx216173 Anti-Insulin Like Growth Factor Binding Protein 5 (IGFBP5) Antibody inquire 50 € abbex human