| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
NUR77 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the NUR77 antibody should be determined by the researcher |
| Intented use: |
This NUR77 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P22736 |
| Purity: |
Antigen affinity |
| Description: |
Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, GFRP1, In addition, In contrast, It plays a key role in mediating inflammatory responses in macrophages, NR4A1 is involved in cell cycle mediation, NUR77 or NGFIB, Nr4a1 is also induced by lithium, Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells, TR3, a Wnt1 downstream effector, a Wnt1 mimic, also called NAK1, and a member of the Nur nuclear receptor family of intracellular transcription factors, and raises blood glucose levels, and the Nr4a1 promoter is activated by lithium and beta-catenin, group A, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells, inflammation and apoptosis, is a protein that in humans is encoded by the NR4A1 gene, member 1, stimulates glucose production both in vitro and in vivo, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells, Nuclear receptor subfamily 4 |
| Immunogen: |
Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NUR77 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
NUR77 |
| Short name: |
NUR77 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
NUR77 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
7980 |
| Gene: |
NR4A1 |
More about : NR4A1 |
| Long gene name: |
nuclear receptor subfamily 4 group A member 1 |
| Synonyms gene: |
HMR GFRP1 |
| Synonyms gene name: |
group A, member 1 , nuclear receptor subfamily 4 |
| Synonyms: |
TR3 N10 NAK-1 NGFIB NUR77 |
| Locus: |
12q13 |
| Discovery year: |
1990-09-10 |
| GenBank acession: |
L13740 |
| Pubmed identfication: |
2626032 |
| Classification: |
Nuclear hormone receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000150393 |