NUR77 Antibody

Contact us
Catalog number: R32021
Price: 370 €
Supplier: MBS mono
Product name: NUR77 Antibody
Quantity: 0.025 miligrams
Other quantities: 0.025 miligrams 315€ 0.1mg 389€ 0.1ml 263€ 0.4 ml 406€ 100ug 630€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: NUR77
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the NUR77 antibody should be determined by the researcher
Intented use: This NUR77 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P22736
Purity: Antigen affinity
Description: Adenoviral expression of Nr4a1 induces genes involved in gluconeogenesis, GFRP1, In addition, In contrast, It plays a key role in mediating inflammatory responses in macrophages, NR4A1 is involved in cell cycle mediation, NUR77 or NGFIB, Nr4a1 is also induced by lithium, Nr4a1 is overexpressed in Wnt1 -transformed mouse mammary cells, TR3, a Wnt1 downstream effector, a Wnt1 mimic, also called NAK1, and a member of the Nur nuclear receptor family of intracellular transcription factors, and raises blood glucose levels, and the Nr4a1 promoter is activated by lithium and beta-catenin, group A, human NR4A1 is not upregulated by beta-catenin, indicating that this gene is regulated differently in human and mouse cells, inflammation and apoptosis, is a protein that in humans is encoded by the NR4A1 gene, member 1, stimulates glucose production both in vitro and in vivo, subcellular localization of the NR4A1 protein appears to play a key role in the survival and death of cells, Nuclear receptor subfamily 4
Immunogen: Amino acids HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD of human NUR77 were used as the immunogen for the NUR77 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NUR77 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: NUR77
Short name: NUR77 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: NUR77 (Antibody to)
Alternative technique: antibodies
Identity: 7980
Gene: NR4A1 | More about : NR4A1
Long gene name: nuclear receptor subfamily 4 group A member 1
Synonyms gene: HMR GFRP1
Synonyms gene name: group A, member 1 , nuclear receptor subfamily 4
Synonyms: TR3 N10 NAK-1 NGFIB NUR77
Locus: 12q13
Discovery year: 1990-09-10
GenBank acession: L13740
Pubmed identfication: 2626032
Classification: Nuclear hormone receptors
Havana BLAST/BLAT: OTTHUMG00000150393

Related Products :

MBS243616 Anti-Human NR4A1 / NUR77 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS421106 Goat anti-Nur77 / TR3 (isoform a) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS242055 Goat Polyclonal to Human NR4A1 / NUR77 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS610452 Nak1 (Nur77) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS611939 Nak1 (Nur77) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS613872 Nak1 (Nur77) Antibody 50ug 724 € MBS Polyclonals_1 human
F49565-0.4ML NUR77 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be3809849bb Nur77 antibody 100ug 630 € MBS mono human
GENTAUR-58be3809e876d Nur77 antibody 0.025 miligrams 315 € MBS mono human
GENTAUR-58be3b6d47eb0 Nur77 antibody 0.025 miligrams 315 € MBS mono human
GENTAUR-58be3b6dc0162 Nur77 antibody 100ug 630 € MBS mono human
MBS272544 NUR77 antibody 100ul 426 € MBS Polyclonals_1 human
R30761 NUR77 Antibody 0.1mg 389 € NJS poly human
R32021 NUR77 Antibody 0.1mg 406 € NJS poly human
R34125-100UG Nur77 Antibody 0.1mg 406 € NJS poly human
bs-3513R-A350 Nur77 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3513R-A488 Nur77 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3513R-A555 Nur77 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3513R-A594 Nur77 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3513R-A647 Nur77 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3513R-Biotin Nur77 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-3513R Nur77 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-3513R-Cy3 Nur77 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3513R-Cy5 Nur77 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3513R-Cy5.5 Nur77 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3513R-Cy7 Nur77 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3513R-FITC Nur77 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-3513R-HRP Nur77 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
F49565-0.08ML NUR77 Antibody (NR4A1) 0.08 ml 199 € NJS poly human
GENTAUR-58be3857838da Nur77 antibody (PE) 0.025 miligrams 370 € MBS mono human