Monoamine Oxidase A Antibody / MAOA

Contact us
Catalog number: R32008
Price: 406 €
Supplier: NJS poly
Product name: Monoamine Oxidase A Antibody / MAOA
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Monoamine Oxidase A / MAOA
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the MAOA antibody should be determined by the researcher
Intented use: This MAOA antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P21397
Purity: Antigen affinity
Description: In humans, Inhibition of MAOA prevented apoptosis, MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder, MAOA degrades amine neurotransmitters, MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11, Mutation in MAOA results in monoamine oxidase deficiency, The protein localizes to the outer mitochondrial membrane, and serotonin, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice, norepinephrine, or Brunner syndrome, such as dopamine, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA, 3, Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene
Immunogen: Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MAOA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Monoamine Oxidase A / MAOA
Short name: Monoamine Oxidase A Antibody / MAOA
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Monoamine Oxidase A (Antibody to) / MAOA
Alternative technique: antibodies
Identity: 6833
Gene: MAOA | More about : MAOA
Long gene name: monoamine oxidase A
Locus: Xp11, 3
Discovery year: 1986-01-01
Entrez gene record: 4128
RefSeq identity: NM_000240
Havana BLAST/BLAT: OTTHUMG00000021387
Locus Specific Databases: Mental Retardation database

Related Products :