| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Monoamine Oxidase A / MAOA |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the MAOA antibody should be determined by the researcher |
| Intented use: |
This MAOA antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P21397 |
| Purity: |
Antigen affinity |
| Description: |
In humans, Inhibition of MAOA prevented apoptosis, MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder, MAOA degrades amine neurotransmitters, MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11, Mutation in MAOA results in monoamine oxidase deficiency, The protein localizes to the outer mitochondrial membrane, and serotonin, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice, norepinephrine, or Brunner syndrome, such as dopamine, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA, 3, Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene |
| Immunogen: |
Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MAOA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Monoamine Oxidase A / MAOA |
| Short name: |
Monoamine Oxidase A Antibody / MAOA |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Monoamine Oxidase A (Antibody to) / MAOA |
| Alternative technique: |
antibodies |
| Identity: |
6833 |
| Gene: |
MAOA |
More about : MAOA |
| Long gene name: |
monoamine oxidase A |
| Locus: |
Xp11, 3 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
4128 |
| RefSeq identity: |
NM_000240 |
| Havana BLAST/BLAT: |
OTTHUMG00000021387 |
| Locus Specific Databases: |
Mental Retardation database |