TCP1 alpha Antibody / CCT1

Contact us
Catalog number: R31992
Price: 406 €
Supplier: NJS poly
Product name: TCP1 alpha Antibody / CCT1
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TCP1 alpha / CCT1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the TCP1 alpha antibody should be determined by the researcher
Intented use: This TCP1 alpha antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P17987
Purity: Antigen affinity
Description: Alternate transcriptional splice variants of this gene, In addition, The complex folds various proteins, The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), This complex consists of two identical stacked rings, Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner, also known as the TCP1 ring complex (TRiC), each containing eight different proteins, encoding different isoforms, have been characterized, including actin and tubulin, three pseudogenes that appear to be derived from this gene have been found, T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene
Immunogen: Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS of human T-complex protein 1 subunit alpha were used as the immunogen for the TCP1 alpha antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TCP1 alpha antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TCP1 alpha / CCT1
Short name: TCP1 alpha Antibody / CCT1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TCP1 a (Antibody to) / CCT1
Alternative technique: antibodies
Identity: 11655
Gene: TCP1 | More about : TCP1
Long gene name: t-complex 1
Synonyms: D6S230E CCT1 Ccta
Locus: 6q25, 3
Discovery year: 2001-06-22
GenBank acession: X52882
Entrez gene record: 6950
Pubmed identfication: 3476253 3653076
RefSeq identity: NM_030752
Classification: Chaperonins
Havana BLAST/BLAT: OTTHUMG00000015937

Related Products :