BMP2 Antibody

Contact us
Catalog number: R31949
Price: 311 €
Supplier: acr
Product name: BMP2 Antibody
Quantity: 5 Вµg
Other quantities: 0.08 ml 199€ 0.1ml 263€ 0.4 ml 406€ 1 vial 532€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: BMP2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ELISA, IHC-P, WB
Recommended dilutions: 1-0, 1-0, 5-1ug/ml, 5ug/ml, 5ug/ml, ELISA: 0, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the BMP2 antibody should be determined by the researcher
Intented use: This BMP2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P12643
Purity: Antigen affinity
Description: Also, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, In addition, It is involved in thehedgehog pathway, It is mapped to 20p12, The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily, and incytokine-cytokine receptor interaction, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition, like otherbone morphogenetic proteins, on the basis of observations in a Drosophila model, BMP-2, BMP2 is also known as Bone morphogenetic protein 2 or BMP2A, TGF beta signaling pathway, plays an important role in the development of bone and cartilage
Immunogen: Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BMP2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: BMP2
Short name: BMP2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: bone morphogenetic protein 2 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: BDA2 and BMP2A, BMP receptor binding, BMP2 and IDBG-52330 and ENSG00000125845 and 650, BMP2 and IDBG-639937 and ENSBTAG00000005111 and 615037, Bmp2 and IDBG-207600 and ENSMUSG00000027358 and 12156, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006954 and inflammatory response and biological process this GO :0007219 and Notch signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007507 and heart development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009790 and embryo development and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0010894 and negative regulation of steroid biosynthetic process and biological process this GO :0010922 and positive regulation of phosphatase activity and biological process this GO :0019211 and phosphatase activator activity and molecular function this GO :0021537 and telencephalon development and biological process this GO :0021978 and telencephalon regionalization and biological process this GO :0030177 and positive regulation of Wnt signaling pathway and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030282 and bone mineralization and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0031648 and protein destabilization and biological process this GO :0032348 and negative regulation of aldosterone biosynthetic process and biological process this GO :0033690 and positive regulation of osteoblast proliferation and biological process this GO :0035051 and cardiac cell differentiation and biological process this GO :0035054 and embryonic heart tube anterior/posterior pattern specification and biological process this GO :0035630 and bone mineralization involved in bone maturation and biological process this GO :0040007 and growth and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042482 and positive regulation of odontogenesis and biological process this GO :0042487 and regulation of odontogenesis of dentin-containing tooth and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043569 and negative regulation of insulin-like growth factor receptor signaling pathway and biological process this GO :0045165 and cell fate commitment and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045600 and positive regulation of fat cell differentiation and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045892 and negative regulation of transcription, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048762 and mesenchymal cell differentiation and biological process this GO :0048839 and inner ear development and biological process this GO :0051042 and negative regulation of calcium-independent cell-cell adhesion and biological process this GO :0055007 and cardiac muscle cell differentiation and biological process this GO :0055008 and cardiac muscle tissue morphogenesis and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0060039 and pericardium development and biological process this GO :0060128 and corticotropin hormone secreting cell differentiation and biological process this GO :0060129 and thyroid-stimulating hormone-secreting cell differentiation and biological process this GO :0060317 and cardiac epithelial to mesenchymal transition and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060395 and SMAD protein signal transduction and biological process this GO :0060485 and mesenchyme development and biological process this GO :0060804 and positive regulation of Wnt receptor signaling pathway by BMP signaling pathway and biological process this GO :0061036 and positive regulation of cartilage development and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070700 and BMP receptor binding and molecular function this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :0072138 and mesenchymal cell proliferation involved in ureteric bud development and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process this GO :1900745 and positive regulation of p38MAPK cascade and biological process this GO :1901522 and positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus and biological process this GO :2000065 and negative regulation of cortisol biosynthetic process and biological process this GO :2000726 and negative regulation of cardiac muscle cell differentiation and biological process, Extracellular, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002062 and chondrocyte differentiation and biological process this GO :0003130 and BMP signaling pathway involved in heart induction and biological process this GO :0003181 and atrioventricular valve morphogenesis and biological process this GO :0003203 and endocardial cushion morphogenesis and biological process this GO :0003308 and negative regulation of Wnt receptor signaling pathway involved in heart development and biological process this GO :0004745 and retinol dehydrogenase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006029 and proteoglycan metabolic process and biological process this GO :0006355 and regulation of transcription, this GO :0004745 : retinol dehydrogenase activity, this GO :0004745 : retinol dehydrogenase activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0019211 : phosphatase activator activity and also this GO :0046332 : SMAD binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0070700 : BMP receptor binding, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0019211 : phosphatase activator activity, this GO :0046332 : SMAD binding, this GO :0046982 : protein heterodimerization activity, this GO :0070700 : BMP receptor binding, bone morphogenetic protein 2
Identity: 1069
Gene: BMP2 | More about : BMP2
Long gene name: bone morphogenetic protein 2
Synonyms gene: BMP2A
Locus: 20p12, 3
Discovery year: 1990-06-11
Entrez gene record: 650
Pubmed identfication: 2376592
Classification: Endogenous ligands Bone morphogenetic proteins
Havana BLAST/BLAT: OTTHUMG00000031833

Related Products :

MBS620831 Bone Morphogenetic Protein 2 Inducible Kinase (BMP-2 Inducible Protein Kinase, BMP2 Inducible Kinase, BMP2 Inducible Protein Kinase, BIKE, BMP2K, DKFZp434K0614, DKFZp434P0116, HRIHFB2017) Antibody 50ug 768 € MBS Polyclonals_1 human
GWB-D2B318 Bone Morphogenetic protein 2 (BMP2) Rabbit antibody to or anti-Human Polyclonal (aa86-102) antibody 1 vial 602 € genways human
BMP-201AP anti-BMP2 Antibody 100 µg 456 € fabgen human
GENTAUR-58bdea8031e89 Anti- BMP2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea808e80d Anti- BMP2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfc4383ff0 Anti- BMP2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc43f34f7 Anti- BMP2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4639a9f92 Anti- BMP2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4b2bb0e61 Anti- BMP2 Antibody 100ug 370 € MBS Polyclonals human
abx128668 Anti-BMP2 Antibody 10 μg 267 € abbex human
abx146659 Anti-BMP2 Antibody inquire 50 € abbex human
abx146666 Anti-BMP2 Antibody 100 μg 311 € abbex human
BMP2-BIOTIN anti-BMP2 Antibody BIOTIN 100 µg 508 € fabgen human
BMP2-FITC anti-BMP2 Antibody FITC 100 µg 508 € fabgen human
AR09127PU-L anti-BMP2 / BMP2A (283-396) Antibody 0,5 mg 1138 € acr human
AR09127PU-N anti-BMP2 / BMP2A (283-396) Antibody 0,1 mg 485 € acr human
AR50430PU-N anti-BMP2 / BMP2A (283-396) Antibody 0,25 mg 1109 € acr human
AR50430PU-S anti-BMP2 / BMP2A (283-396) Antibody 50 Вµg 485 € acr human
AP09919PU-N anti-BMP2 / BMP2A (45-60) Antibody 0,1 mg 659 € acr human
AP07889PU-N anti-BMP2 / BMP2A (86-102) Antibody 50 Вµg 732 € acr human
AP20597PU-N anti-BMP2 / BMP2A (aa 261-290) Antibody 0,1 mg 558 € acr human
AM50066PU-N anti-BMP2 / BMP2A Antibody 0,1 ml 500 € acr human
AM50066PU-S anti-BMP2 / BMP2A Antibody 50 Вµl 369 € acr human
CPA1097-100ul anti-BMP2 / BMP2A Antibody 0,1 ml 442 € acr human
CPA1097-200ul anti-BMP2 / BMP2A Antibody 0,2 ml 688 € acr human
CPA1097-30ul anti-BMP2 / BMP2A Antibody 30 Вµl 326 € acr human
CPA4352-100ul anti-BMP2 / BMP2A Antibody 0,1 ml 442 € acr human
CPA4352-200ul anti-BMP2 / BMP2A Antibody 0,2 ml 688 € acr human
CPA4352-30ul anti-BMP2 / BMP2A Antibody 30 Вµl 326 € acr human
DA3502 anti-BMP2 / BMP2A Antibody 5 Вµg 311 € acr human