| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PTPRF / LAR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PTPRF antibody should be determined by the researcher |
| Intented use: |
This PTPRF antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P10586 |
| Purity: |
Antigen affinity |
| Description: |
An increased expression level of this protein was found in the insulin-responsive tissue of obese, PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, The extracellular region contains three Ig-like domains, The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family, This PTP possesses an extracellular region, This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, Two alternatively spliced transcript variants of this gene, a single transmembrane region, and may contribute to the pathogenesis of insulin resistance, and nine non-Ig like domains similar to that of neural-cell adhesion molecule, and oncogenic transformation, and thus represents a receptor-type PTP, and two tandem intracytoplasmic catalytic domains, as well as in the control of beta-catenin signaling, differentiation, have been reported, insulin-resistant individuals, mitotic cycle, which encode distinct proteins, Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene |
| Immunogen: |
Amino acids EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK of human PTPRF were used as the immunogen for the PTPRF antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PTPRF antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PTPRF / LAR |
| Short name: |
PTPRF Antibody / LAR |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
F (Antibody to) / LAR, receptor classification, protein tyrosine phosphatase |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BNAH2 and LAR, F, PTPRF and IDBG-640420 and ENSBTAG00000000253 and 512072, PTPRF and IDBG-97490 and ENSG00000142949 and 5792, Plasma membranes, Ptprf and IDBG-180768 and ENSMUSG00000033295 and 19268, protein complex binding, receptor type, this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005001 and transmembrane receptor protein tyrosine phosphatase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0007155 and cell adhesion and biological process this GO :0007185 and transmembrane receptor protein tyrosine phosphatase signaling pathway and biological process this GO :0008201 and heparin binding and molecular function this GO :0016311 and dephosphorylation and biological process this GO :0016477 and cell migration and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0032403 and protein complex binding and molecular function this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1900121 and negative regulation of receptor binding and biological process, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity and also this GO :0005515 : protein binding and also this GO :0008201 : heparin binding and also this GO :0016791 : phosphatase activity and also this GO :0032403 : protein complex binding, this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity, this GO :0005515 : protein binding, this GO :0008201 : heparin binding, this GO :0016791 : phosphatase activity, this GO :0032403 : protein complex binding, protein tyrosine phosphatase |
| Identity: |
9670 |
| Gene: |
PTPRF |
More about : PTPRF |
| Long gene name: |
protein tyrosine phosphatase, receptor type F |
| Synonyms gene: |
LAR |
| Locus: |
1p34, 2 |
| Discovery year: |
1989-06-30 |
| GenBank acession: |
Y00815 |
| Entrez gene record: |
5792 |
| Pubmed identfication: |
7558042 |
| Classification: |
Fibronectin type III domain containing I-set domain containing Protein tyrosine phosphatases, receptor type |
| Havana BLAST/BLAT: |
OTTHUMG00000007501 |