PTPRF Antibody / LAR

Contact us
Catalog number: R31936
Price: 406 €
Supplier: NJS poly
Product name: PTPRF Antibody / LAR
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PTPRF / LAR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PTPRF antibody should be determined by the researcher
Intented use: This PTPRF antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P10586
Purity: Antigen affinity
Description: An increased expression level of this protein was found in the insulin-responsive tissue of obese, PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, The extracellular region contains three Ig-like domains, The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family, This PTP possesses an extracellular region, This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, Two alternatively spliced transcript variants of this gene, a single transmembrane region, and may contribute to the pathogenesis of insulin resistance, and nine non-Ig like domains similar to that of neural-cell adhesion molecule, and oncogenic transformation, and thus represents a receptor-type PTP, and two tandem intracytoplasmic catalytic domains, as well as in the control of beta-catenin signaling, differentiation, have been reported, insulin-resistant individuals, mitotic cycle, which encode distinct proteins, Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene
Immunogen: Amino acids EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK of human PTPRF were used as the immunogen for the PTPRF antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PTPRF antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PTPRF / LAR
Short name: PTPRF Antibody / LAR
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: F (Antibody to) / LAR, receptor classification, protein tyrosine phosphatase
Alternative technique: antibodies
Alternative to gene target: BNAH2 and LAR, F, PTPRF and IDBG-640420 and ENSBTAG00000000253 and 512072, PTPRF and IDBG-97490 and ENSG00000142949 and 5792, Plasma membranes, Ptprf and IDBG-180768 and ENSMUSG00000033295 and 19268, protein complex binding, receptor type, this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005001 and transmembrane receptor protein tyrosine phosphatase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0007155 and cell adhesion and biological process this GO :0007185 and transmembrane receptor protein tyrosine phosphatase signaling pathway and biological process this GO :0008201 and heparin binding and molecular function this GO :0016311 and dephosphorylation and biological process this GO :0016477 and cell migration and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0032403 and protein complex binding and molecular function this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1900121 and negative regulation of receptor binding and biological process, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity and also this GO :0005515 : protein binding and also this GO :0008201 : heparin binding and also this GO :0016791 : phosphatase activity and also this GO :0032403 : protein complex binding, this GO :0005001 : transmembrane receptor protein tyrosine phosphatase activity, this GO :0005515 : protein binding, this GO :0008201 : heparin binding, this GO :0016791 : phosphatase activity, this GO :0032403 : protein complex binding, protein tyrosine phosphatase
Identity: 9670
Gene: PTPRF | More about : PTPRF
Long gene name: protein tyrosine phosphatase, receptor type F
Synonyms gene: LAR
Locus: 1p34, 2
Discovery year: 1989-06-30
GenBank acession: Y00815
Entrez gene record: 5792
Pubmed identfication: 7558042
Classification: Fibronectin type III domain containing I-set domain containing Protein tyrosine phosphatases, receptor type
Havana BLAST/BLAT: OTTHUMG00000007501

Related Products :