| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GSTA (alpha 1-5) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the GSTA antibody should be determined by the researcher |
| Intented use: |
This GSTA antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P08263 |
| Purity: |
Antigen affinity |
| Description: |
At present, In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, The alpha class genes, The genes encoding these enzymes are known to be highly polymorphic, These enzymes function in the detoxification of electrophilic compounds, These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs, This gene encodes a glutathione S-transferase belonging to the alpha class, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules), by conjugation with glutathione, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, environmental toxins and products of oxidative stress, including carcinogens, kappa, located in a cluster mapped to chromosome 6, mu, omega, pi, sigma, the alpha class of these enzymes exhibit glutathione peroxidase activity, therapeutic drugs, thereby protecting the cells from reactive oxygen species and the products of peroxidation, theta and zeta, Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families |
| Immunogen: |
Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE of human GSTA(1-5) were used as the immunogen for the GSTA antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GSTA antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GSTA (alpha 1-5) |
| Short name: |
GSTA Antibody (alpha 1-5) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GSTA (Antibody to) (a 1-5) |
| Alternative technique: |
antibodies |