| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Integrin beta 3 / ITGB3 / CD61 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the CD61 antibody should be determined by the researcher |
| Intented use: |
This CD61 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P05106 |
| Purity: |
Antigen affinity |
| Description: |
Additionally, Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, GPIIIa, It is a cluster of differentiation found on thrombocytes, The 3-prime exon is larger than 1, The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits, also called GP3A, and CD61, is a protein that in humans is encoded by the ITGB3 gene, it could not be activated via the 'inside-out' signaling pathways, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen, 700 nucleotides and contains the 3-prime untranslated region, Integrin beta 3 |
| Immunogen: |
Amino acids FAKFEEERARAKWDTANNPLYKEATSTFTNITYR of human CD61 were used as the immunogen for the CD61 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CD61 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Cell surface |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Integrin beta 3 / ITGB3 / CD61 |
| Short name: |
Integrin beta 3 Antibody / ITGB3 / CD61 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
antigen CD61) / CD61, b 3 (platelet glycoprotein IIIa, Integrin b 3 (Antibody to) / integrin |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BDPLT16 and BDPLT2 and CD61 and GP3A and GPIIIa and GT, ITGB3 and IDBG-547297 and ENSG00000259207 and 3690, antigen CD61), beta 3 (platelet glycoprotein IIIa, cell adhesion molecule binding, nuclei, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003756 and protein disulfide isomerase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005161 and platelet-derived growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006457 and protein folding and biological process this GO :0007044 and cell-substrate junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007411 and axon guidance and biological process this GO :0007596 and blood coagulation and biological process this GO :0008305 and integrin complex and cellular component this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014909 and smooth muscle cell migration and biological process this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030949 and positive regulation of vascular endothelial growth factor receptor signaling pathway and biological process this GO :0031092 and platelet alpha granule membrane and cellular component this GO :0031258 and lamellipodium membrane and cellular component this GO :0031589 and cell-substrate adhesion and biological process this GO :0032147 and activation of protein kinase activity and biological process this GO :0032369 and negative regulation of lipid transport and biological process this GO :0035295 and tube development and biological process this GO :0042060 and wound healing and biological process this GO :0042470 and melanosome and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0043184 and vascular endothelial growth factor receptor 2 binding and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045124 and regulation of bone resorption and biological process this GO :0045715 and negative regulation of low-density lipoprotein particle receptor biosynthetic process and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050748 and negative regulation of lipoprotein metabolic process and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0050900 and leukocyte migration and biological process this GO :0060055 and angiogenesis involved in wound healing and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process this GO :0071062 and alphav-beta3 integrin-vitronectin complex and cellular component, this GO :0003756 : protein disulfide isomerase activity, this GO :0003756 : protein disulfide isomerase activity and also this GO :0004872 : receptor activity and also this GO :0005161 : platelet-derived growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0043184 : vascular endothelial growth factor receptor 2 binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0004872 : receptor activity, this GO :0005161 : platelet-derived growth factor receptor binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0043184 : vascular endothelial growth factor receptor 2 binding, this GO :0050839 : cell adhesion molecule binding, integrin |
| Identity: |
6156 |
| Gene: |
ITGB3 |
More about : ITGB3 |
| Long gene name: |
integrin subunit beta 3 |
| Synonyms gene: |
GP3A |
| Synonyms gene name: |
antigen CD61) , beta 3 (platelet glycoprotein IIIa, integrin |
| Synonyms: |
CD61 GPIIIa |
| Synonyms name: |
platelet glycoprotein IIIa antigen CD61 |
| Locus: |
17q21, 32 |
| Discovery year: |
1988-06-09 |
| Entrez gene record: |
3690 |
| Pubmed identfication: |
2454952 |
| RefSeq identity: |
NM_000212 |
| Classification: |
Integrin beta subunits CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000171956 |
| Locus Specific Databases: |
LRG_481 |