Integrin beta 3 Antibody / ITGB3 / CD61

Contact us
Catalog number: R31891
Price: 384 €
Supplier: acr
Product name: Integrin beta 3 Antibody / ITGB3 / CD61
Quantity: 50 Вµl
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Integrin beta 3 / ITGB3 / CD61
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the CD61 antibody should be determined by the researcher
Intented use: This CD61 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P05106
Purity: Antigen affinity
Description: Additionally, Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, GPIIIa, It is a cluster of differentiation found on thrombocytes, The 3-prime exon is larger than 1, The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits, also called GP3A, and CD61, is a protein that in humans is encoded by the ITGB3 gene, it could not be activated via the 'inside-out' signaling pathways, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen, 700 nucleotides and contains the 3-prime untranslated region, Integrin beta 3
Immunogen: Amino acids FAKFEEERARAKWDTANNPLYKEATSTFTNITYR of human CD61 were used as the immunogen for the CD61 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CD61 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Cell surface
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Integrin beta 3 / ITGB3 / CD61
Short name: Integrin beta 3 Antibody / ITGB3 / CD61
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: antigen CD61) / CD61, b 3 (platelet glycoprotein IIIa, Integrin b 3 (Antibody to) / integrin
Alternative technique: antibodies
Alternative to gene target: BDPLT16 and BDPLT2 and CD61 and GP3A and GPIIIa and GT, ITGB3 and IDBG-547297 and ENSG00000259207 and 3690, antigen CD61), beta 3 (platelet glycoprotein IIIa, cell adhesion molecule binding, nuclei, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003756 and protein disulfide isomerase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005161 and platelet-derived growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006457 and protein folding and biological process this GO :0007044 and cell-substrate junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007411 and axon guidance and biological process this GO :0007596 and blood coagulation and biological process this GO :0008305 and integrin complex and cellular component this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014909 and smooth muscle cell migration and biological process this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030949 and positive regulation of vascular endothelial growth factor receptor signaling pathway and biological process this GO :0031092 and platelet alpha granule membrane and cellular component this GO :0031258 and lamellipodium membrane and cellular component this GO :0031589 and cell-substrate adhesion and biological process this GO :0032147 and activation of protein kinase activity and biological process this GO :0032369 and negative regulation of lipid transport and biological process this GO :0035295 and tube development and biological process this GO :0042060 and wound healing and biological process this GO :0042470 and melanosome and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0043184 and vascular endothelial growth factor receptor 2 binding and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045124 and regulation of bone resorption and biological process this GO :0045715 and negative regulation of low-density lipoprotein particle receptor biosynthetic process and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050748 and negative regulation of lipoprotein metabolic process and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0050900 and leukocyte migration and biological process this GO :0060055 and angiogenesis involved in wound healing and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process this GO :0071062 and alphav-beta3 integrin-vitronectin complex and cellular component, this GO :0003756 : protein disulfide isomerase activity, this GO :0003756 : protein disulfide isomerase activity and also this GO :0004872 : receptor activity and also this GO :0005161 : platelet-derived growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0043184 : vascular endothelial growth factor receptor 2 binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0004872 : receptor activity, this GO :0005161 : platelet-derived growth factor receptor binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0043184 : vascular endothelial growth factor receptor 2 binding, this GO :0050839 : cell adhesion molecule binding, integrin
Identity: 6156
Gene: ITGB3 | More about : ITGB3
Long gene name: integrin subunit beta 3
Synonyms gene: GP3A
Synonyms gene name: antigen CD61) , beta 3 (platelet glycoprotein IIIa, integrin
Synonyms: CD61 GPIIIa
Synonyms name: platelet glycoprotein IIIa antigen CD61
Locus: 17q21, 32
Discovery year: 1988-06-09
Entrez gene record: 3690
Pubmed identfication: 2454952
RefSeq identity: NM_000212
Classification: Integrin beta subunits CD molecules
Havana BLAST/BLAT: OTTHUMG00000171956
Locus Specific Databases: LRG_481

Related Products :

AM26367PU-N anti-CD61 / ITGB3 (+Beta-3 Integrin) Antibody 0,1 mg 616 € acr human
MBS240178 Anti-Human ITGB3 / Integrin Beta 3 / CD61 Antibody 50ug 597 € MBS Polyclonals_1 human
R31891 Integrin beta 3 Antibody / ITGB3 / CD61 0.1mg 406 € NJS poly human
MBS395810 Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) (ITGB3) Antibody 50ug 597 € MBS Polyclonals_1 human
MBS395929 Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) (ITGB3) Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde76bd49b5 Mouse Monoclonal [clone VI-PL2] (IgG1,k) to Human ITGB3 / Integrin Beta 3 / CD61 Antibody 50ug 597 € MBS mono human
MBS240177 Anti-Human ITGB3 / Integrin Beta 3 / CD61 50ug 597 € MBS Polyclonals_1 human
MBS623858 Integrin, beta3, CT (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621028 Integrin, beta3 (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS624603 Integrin, beta3, phosphorylated (Tyr773) (Platelet Glycoprotein IIIa, CD61, GP3A, GPIIIa, ITGB3, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 481 € MBS Polyclonals_1 human
GWB-19D45B antibody to or anti- Integrin B 3 (platelet Glycoprotein IIIa Antigen CD61) (ITGB3) Human antibody 1 x 1 vial 1053 € genways human
GWB-FDB7C0 antibody to or anti- Integrin B 3 (platelet Glycoprotein IIIa Antigen CD61) (ITGB3) Human antibody 1 vial 1053 € genways human
GWB-C16570 Integrin B 3 (platelet Glycoprotein IIIa Antigen CD61) (ITGB3) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-F4030D Integrin B 3 (platelet Glycoprotein IIIa Antigen CD61) (ITGB3) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
MBS623389 Integrin beta-like 1 with EGF-like Repeat Domains (Integrin beta-like Protein 1, ITGBL1, Osteoblast-specific Cysteine-rich Protein, OSCP, Ten Integrin EGF-like Repeat Domain-containing Protein, TIED) Antibody 200ul 603 € MBS Polyclonals_1 human
GWB-BBP502 Polyclonal antibody to or anti- ITGB3/CD61 antibody 1 vial 463 € genways human
AM05196FC-N anti-CD61 / ITGB3 Antibody 100 Tests 442 € acr human
AM05196PU-N anti-CD61 / ITGB3 Antibody 0,1 mg 413 € acr human
AM05196RP-N anti-CD61 / ITGB3 Antibody 100 Tests 485 € acr human
AM05881FC-N anti-CD61 / ITGB3 Antibody 0,1 mg 819 € acr human
AM05881PU-S anti-CD61 / ITGB3 Antibody 0,1 mg 442 € acr human
AM10070SU-N anti-CD61 / ITGB3 Antibody 1 ml 833 € acr human
AM26143AC-N anti-CD61 / ITGB3 Antibody 100 Tests 471 € acr human
AM26143PU-N anti-CD61 / ITGB3 Antibody 0,1 mg 355 € acr human
AM26284PU-N anti-CD61 / ITGB3 Antibody 0,1 mg 616 € acr human
AM26637AF-N anti-CD61 / ITGB3 Antibody 0,1 mg 543 € acr human
AM32082PU-N anti-CD61 / ITGB3 Antibody 0,1 mg 688 € acr human
AM32328PU-N anti-CD61 / ITGB3 Antibody 1 ml 558 € acr human
AP02622PU-N anti-CD61 / ITGB3 Antibody 0,1 ml 442 € acr human
AP02622PU-S anti-CD61 / ITGB3 Antibody 50 Вµl 384 € acr human