Superoxide Dismutase 2 Antibody / SOD2

Contact us
Catalog number: R31882
Price: 406 €
Supplier: NJS poly
Product name: Superoxide Dismutase 2 Antibody / SOD2
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Superoxide Dismutase 2 / SOD2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SOD2 antibody should be determined by the researcher
Intented use: This SOD2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P04179
Purity: Antigen affinity
Description: Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells, The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation, The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, This gene is a member of the iron/manganese superoxide dismutase family, Using a somatic cell hybrid panel containing different segments of chromosome 6, also called IPO-B or MNSOD, and that expression of SOD2 attenuated the disease process, indicated that SOD2 is in the distal portion of 6q25, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria, they demonstrated that SOD2 is located in the region 6q25, together with the FISH analysis, 3-qter which, SOD2 (Superoxide Dismutase 2)
Immunogen: Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2 were used as the immunogen for the SOD2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SOD2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Superoxide Dismutase 2 / SOD2
Short name: Superoxide Dismutase 2 Antibody / SOD2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: mitochondrial, Superoxide Dismutase 2 (Antibody to) / superoxide dismutase 2
Alternative technique: antibodies
Alternative to gene target: Cytoplasm, IPOB and MNSOD and MVCD6, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, metal ion binding, mitochondrial, this GO :0000302 and response to reactive oxygen species and biological process this GO :0000303 and response to superoxide and biological process this GO :0001306 and age-dependent response to oxidative stress and biological process this GO :0001315 and age-dependent response to reactive oxygen species and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0001889 and liver development and biological process this GO :0003032 and detection of oxygen and biological process this GO :0003069 and vasodilation by acetylcholine involved in regulation of systemic arterial blood pressure and biological process this GO :0003677 and DNA binding and molecular function this GO :0004784 and superoxide dismutase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006749 and glutathione metabolic process and biological process this GO :0006801 and superoxide metabolic process and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0007005 and mitochondrion organization and biological process this GO :0007507 and heart development and biological process this GO :0007568 and aging and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0009314 and response to radiation and biological process this GO :0009409 and response to cold and biological process this GO :0009791 and post-embryonic development and biological process this GO :0010042 and response to manganese ion and biological process this GO :0010043 and response to zinc ion and biological process this GO :0010269 and response to selenium ion and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0014823 and response to activity and biological process this GO :0019430 and removal of superoxide radicals and biological process this GO :0019825 and oxygen binding and molecular function this GO :0022904 and respiratory electron transport chain and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030145 and manganese ion binding and molecular function this GO :0031667 and response to nutrient levels and biological process this GO :0032364 and oxygen homeostasis and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033591 and response to L-ascorbic acid and biological process this GO :0034021 and response to silicon dioxide and biological process this GO :0035900 and response to isolation stress and biological process this GO :0035902 and response to immobilization stress and biological process this GO :0042311 and vasodilation and biological process this GO :0042493 and response to drug and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042554 and superoxide anion generation and biological process this GO :0042645 and mitochondrial nucleoid and cellular component this GO :0042743 and hydrogen peroxide metabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048147 and negative regulation of fibroblast proliferation and biological process this GO :0048666 and neuron development and biological process this GO :0048678 and response to axon injury and biological process this GO :0048773 and erythrophore differentiation and biological process this GO :0050665 and hydrogen peroxide biosynthetic process and biological process this GO :0050790 and regulation of catalytic activity and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051289 and protein homotetramerization and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0055072 and iron ion homeostasis and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071000 and response to magnetism and biological process this GO :0071361 and cellular response to ethanol and biological process this GO :1902176 and negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0004784 : superoxide dismutase activity and also this GO :0005515 : protein binding and also this GO :0019825 : oxygen binding and also this GO :0030145 : manganese ion binding and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding, this GO :0004784 : superoxide dismutase activity, this GO :0005515 : protein binding, this GO :0019825 : oxygen binding, this GO :0030145 : manganese ion binding, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, 6648, superoxide dismutase 2
Identity: 11180
Gene: SOD2 | More about : SOD2
Long gene name: superoxide dismutase 2
Synonyms gene name: mitochondrial , superoxide dismutase 2
Locus: 6q25, 3
Discovery year: 1986-01-01
GenBank acession: M36693
Entrez gene record: 6648
RefSeq identity: NM_000636
Havana BLAST/BLAT: OTTHUMG00000015940
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

MBS620593 Superoxide Dismutase, Mn (Manganese Superoxide Dismutase, Manganese SOD, Mn SOD, MnSOD, IPO-B, Superoxide Dismutase [Mn] Mitochondrial Precursor, Superoxide Dismutase 2 Mitochondrial, SOD 2, SOD2, SOD-2) Antibody 0.05 ml 669 € MBS Polyclonals_1 human
MBS621026 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, CuZnSOD, SODC, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Ipo1, Ipo-1, Superoxide Dismutase 1 (Soluble), SOD1, SOD-1) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS619705 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Homodimer, Indophenoloxidase A, IPOA, Superoxide Dismutase 1, Superoxide Dismutase 1 Soluble, SOD1, SOD-1, Superoxide Dismutase Cyst Antibody 100ul 652 € MBS Polyclonals_1 human
GENTAUR-58bdc4c69957a Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc5d2422cf Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc657eaa5e Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc65866376 Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc6e18c2e8 Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc7c336e68 Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc7c39002b Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdceba8723f Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcebb083bc Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd6274c2b9 Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd7b241aaf Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd8e03b85f Anti- Superoxide Dismutase 2, Mitochondrial (SOD2) Antibody 100ug 580 € MBS Polyclonals human
AR09977PU-L anti-Superoxide Dismutase 2 / SOD2 (1-206, His-tag) Antibody 0,5 mg 1138 € acr human
AR09977PU-N anti-Superoxide Dismutase 2 / SOD2 (1-206, His-tag) Antibody 0,1 mg 485 € acr human
AR09412PU-L anti-Superoxide dismutase 2 / SOD2 (25-222, His-tag) Antibody 0,5 mg 1022 € acr human
AR09412PU-N anti-Superoxide dismutase 2 / SOD2 (25-222, His-tag) Antibody 0,1 mg 413 € acr human
AR51896PU-N anti-Superoxide dismutase 2 / SOD2 (25-222, His-tag) Antibody 0,5 mg 1109 € acr human
AR51896PU-S anti-Superoxide dismutase 2 / SOD2 (25-222, His-tag) Antibody 0,1 mg 485 € acr human
AM11059PU-N anti-Superoxide dismutase 2 / SOD2 Antibody 0,4 ml 587 € acr human
AP03023PU-S anti-Superoxide dismutase 2 / SOD2 Antibody 25 Вµg 398 € acr human
AP03024PU-S anti-Superoxide dismutase 2 / SOD2 Antibody 25 Вµg 398 € acr human
AP31424PU-N anti-Superoxide dismutase 2 / SOD2 Antibody 50 Вµl 732 € acr human
BB-PA1776 anti-Superoxide dismutase 2 / SOD2 Antibody 0,1 mg 471 € acr human
MO15122-100 anti-Superoxide dismutase 2 / SOD2 Antibody 0,1 mg 543 € acr human
R30869 SOD2 Antibody Superoxide Dismutase 2 0.1mg 389 € NJS poly human
F50529-0.08ML Superoxide Dismutase 2 Antibody (SOD2) 0.08 ml 199 € NJS poly human
R31882 Superoxide Dismutase 2 Antibody / SOD2 0.1mg 406 € NJS poly human