| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
STAU1 / Staufen |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the STAU1 antibody should be determined by the researcher |
| Intented use: |
This STAU1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O95793 |
| Purity: |
Antigen affinity |
| Description: |
Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described, Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles, The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), The human homologue of staufen encoded by STAU, These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures, Three of these variants encode the same isoform, and binds tubulin, differ in their 5'UTR, however, implicating this protein in the transport of mRNA via the microtubule network to the RER, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, the site of translation, Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene |
| Immunogen: |
Amino acids HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN of human Staufen were used as the immunogen for the STAU1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the STAU1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
STAU1 / Staufen |
| Short name: |
STAU1 Antibody / Staufen |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
STAU1 (Antibody to) / Staufen |
| Alternative technique: |
antibodies |
| Identity: |
11370 |
| Gene: |
STAU1 |
More about : STAU1 |
| Long gene name: |
staufen double-stranded RNA binding protein 1 |
| Synonyms gene: |
STAU |
| Synonyms gene name: |
RNA binding protein, RNA binding protein (Drosophila) staufen, RNA-binding protein) staufen, homolog 1 (Drosophila) , staufen (Drosophila |
| Synonyms: |
PPP1R150 |
| Synonyms name: |
protein phosphatase 1, regulatory subunit 150 |
| Locus: |
20q13, 13 |
| Discovery year: |
1996-04-22 |
| Entrez gene record: |
6780 |
| Pubmed identfication: |
8884277 15680326 |
| RefSeq identity: |
NM_017453 |
| Classification: |
Protein phosphatase 1 regulatory subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000032691 |