STAU1 Antibody / Staufen

Contact us
Catalog number: R31848
Price: 406 €
Supplier: NJS poly
Product name: STAU1 Antibody / Staufen
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: STAU1 / Staufen
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the STAU1 antibody should be determined by the researcher
Intented use: This STAU1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O95793
Purity: Antigen affinity
Description: Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described, Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles, The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), The human homologue of staufen encoded by STAU, These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures, Three of these variants encode the same isoform, and binds tubulin, differ in their 5'UTR, however, implicating this protein in the transport of mRNA via the microtubule network to the RER, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, the site of translation, Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene
Immunogen: Amino acids HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN of human Staufen were used as the immunogen for the STAU1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the STAU1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: STAU1 / Staufen
Short name: STAU1 Antibody / Staufen
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: STAU1 (Antibody to) / Staufen
Alternative technique: antibodies
Identity: 11370
Gene: STAU1 | More about : STAU1
Long gene name: staufen double-stranded RNA binding protein 1
Synonyms gene: STAU
Synonyms gene name: RNA binding protein, RNA binding protein (Drosophila) staufen, RNA-binding protein) staufen, homolog 1 (Drosophila) , staufen (Drosophila
Synonyms: PPP1R150
Synonyms name: protein phosphatase 1, regulatory subunit 150
Locus: 20q13, 13
Discovery year: 1996-04-22
Entrez gene record: 6780
Pubmed identfication: 8884277 15680326
RefSeq identity: NM_017453
Classification: Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT: OTTHUMG00000032691

Related Products :