| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
DGAT1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the DGAT antibody should be determined by the researcher |
| Intented use: |
This DGAT antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O75907 |
| Purity: |
Antigen affinity |
| Description: |
DGAT had been considered necessary for adipose tissue formation and essential for survival, DGAT1 is a host factor for HCV infection that binds core protein, DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2, and recruits viral RNA replication complexes for viral assembly, localizes it to DGAT1-generated lipid droplets, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics, Acyl-CoA: diacylglycerol acyltransferase 1 (DGAT1) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates |
| Immunogen: |
Amino acids RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR of human DGAT1 were used as the immunogen for the DGAT antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DGAT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
DGAT1 |
| Short name: |
DGAT1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
DGAT1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2843 |
| Gene: |
DGAT1 |
More about : DGAT1 |
| Long gene name: |
diacylglycerol O-acyltransferase 1 |
| Synonyms gene name: |
diacylglycerol O-acyltransferase homolog 1 (mouse) |
| Synonyms: |
ARGP1 DGAT |
| Locus: |
8q24, 3 |
| Discovery year: |
1998-11-11 |
| GenBank acession: |
AF059202 |
| Entrez gene record: |
8694 |
| Pubmed identfication: |
9756920 |
| RefSeq identity: |
NM_012079 |
| Havana BLAST/BLAT: |
OTTHUMG00000174606 |