DGAT1 Antibody

Contact us
Catalog number: R31838
Price: 50 €
Supplier: abbex
Product name: DGAT1 Antibody
Quantity: inquire
Other quantities: 0.1mg 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: DGAT1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the DGAT antibody should be determined by the researcher
Intented use: This DGAT antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O75907
Purity: Antigen affinity
Description: DGAT had been considered necessary for adipose tissue formation and essential for survival, DGAT1 is a host factor for HCV infection that binds core protein, DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2, and recruits viral RNA replication complexes for viral assembly, localizes it to DGAT1-generated lipid droplets, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics, Acyl-CoA: diacylglycerol acyltransferase 1 (DGAT1) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates
Immunogen: Amino acids RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR of human DGAT1 were used as the immunogen for the DGAT antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the DGAT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: DGAT1
Short name: DGAT1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: DGAT1 (Antibody to)
Alternative technique: antibodies
Identity: 2843
Gene: DGAT1 | More about : DGAT1
Long gene name: diacylglycerol O-acyltransferase 1
Synonyms gene name: diacylglycerol O-acyltransferase homolog 1 (mouse)
Synonyms: ARGP1 DGAT
Locus: 8q24, 3
Discovery year: 1998-11-11
GenBank acession: AF059202
Entrez gene record: 8694
Pubmed identfication: 9756920
RefSeq identity: NM_012079
Havana BLAST/BLAT: OTTHUMG00000174606

Related Products :

AP32857PU-N anti-DGAT1 (67-79) Antibody 0,1 mg 558 € acr human
GENTAUR-58bdeae2967d4 Anti- DGAT1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdeae30d369 Anti- DGAT1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf455ad8e9 Anti- DGAT1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf4560c4c8 Anti- DGAT1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0b73eefb6 Anti- DGAT1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0b744cce6 Anti- DGAT1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdc2a79b1b3 Anti- Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc2a818036 Anti- Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd2b114c45 Anti- Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddcb805e18 Anti- Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) Antibody 100ug 564 € MBS Polyclonals human
R31838 DGAT1 Antibody 0.1mg 406 € NJS poly human
R35384-100UG DGAT1 Antibody 0.1mg 406 € NJS poly human
R35545-100UG DGAT1 Antibody 0.1mg 406 € NJS poly human
MBS616758 DGAT1 (Diacylglycerol O-acyltransferase 1, EC 2.3.1.20, Diglyceride Acyltransferase, ACT-related Gene Product 1) Antibody 100ul 630 € MBS Polyclonals_1 human
MBS423224 Goat anti-DGAT1 (aa67-79) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS420612 Goat anti-DGAT1 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS243054 Goat Polyclonal to Human DGAT1 / DGAT Antibody 50ug 597 € MBS Polyclonals_1 human
MBS248182 Goat Polyclonal to Human DGAT1 / DGAT Antibody 50ug 597 € MBS Polyclonals_1 human
abx901478 Anti-DGAT1 siRNA inquire 50 € abbex human
abx914045 Anti-DGAT1 siRNA inquire 50 € abbex human
abx914046 Anti-DGAT1 siRNA 30 nmol 717 € abbex human
abx151307 Anti-Human DGAT1 ELISA Kit 96 tests 934 € abbex human
abx257432 Anti-Human DGAT1 ELISA Kit inquire 50 € abbex human
abx572424 Anti-Human DGAT1 ELISA Kit inquire 50 € abbex human
abx153914 Anti-Mouse DGAT1 ELISA Kit 96 tests 949 € abbex mouse
abx257433 Anti-Mouse DGAT1 ELISA Kit inquire 50 € abbex mouse
abx572710 Anti-Mouse DGAT1 ELISA Kit inquire 50 € abbex mouse
abx155437 Anti-Rat DGAT1 ELISA Kit inquire 50 € abbex rat
abx573579 Anti-Rat DGAT1 ELISA Kit inquire 50 € abbex rat