| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MEFV / Mediterranean fever |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MEFV antibody should be determined by the researcher |
| Intented use: |
This MEFV antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15553 |
| Purity: |
Antigen affinity |
| Description: |
Although pyrin's function is not fully understood, And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed, Inside these white blood cells, Pyrin is produced in certain white blood cells (neutrophils, Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response, Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton, and movement of a cell, eosinophils and monocytes) that play a role in inflammation and in fighting infection, it likely assists in keeping the inflammation process under control, pyrin is found with thecytoskeleton, size, the structural framework that helps to define the shape, MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin) |
| Immunogen: |
Amino acids PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR of human MEFV were used as the immunogen for the MEFV antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEFV antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MEFV / Mediterranean fever |
| Short name: |
MEFV Antibody / Mediterranean fever |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MEFV (Antibody to) / Mediterranean fever |
| Alternative technique: |
antibodies |
| Identity: |
6998 |
| Gene: |
MEFV |
More about : MEFV |
| Long gene name: |
MEFV, pyrin innate immunity regulator |
| Synonyms gene: |
MEF |
| Synonyms gene name: |
Mediterranean fever |
| Synonyms: |
FMF TRIM20 |
| Synonyms name: |
marenostrin |
| Locus: |
16p13, 3 |
| Discovery year: |
1989-10-30 |
| GenBank acession: |
AF018080 |
| Entrez gene record: |
4210 |
| Pubmed identfication: |
9288094 27066000 |
| RefSeq identity: |
NM_000243 |
| Classification: |
Tripartite motif containing Pyrin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000129324 |
| Locus Specific Databases: |
INFEVERS: The repertory of Familial Mediterranean Fever (FMF) and Hereditary Inflammatory Disorders Mutations LRG_190 |