| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SLC22A2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SLC22A2 antibody should be determined by the researcher |
| Intented use: |
This SLC22A2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15244 |
| Purity: |
Antigen affinity |
| Description: |
It is found primarily in the kidney, It is mapped to 6q25, Polyspecific organic cation transporters in the liver, The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein, This gene is one of three similar cation transporter genes located in a cluster on chromosome 6, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins, intestine, kidney, where it may mediate the first step in cation reabsorption, 3, SLC22A2 is also known as OCT2 |
| Immunogen: |
Amino acids ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN of human SLC22A2 were used as the immunogen for the SLC22A2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLC22A2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SLC22A2 |
| Short name: |
SLC22A2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SLC22A2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
10966 |
| Gene: |
SLC22A2 |
More about : SLC22A2 |
| Long gene name: |
solute carrier family 22 member 2 |
| Synonyms gene name: |
member 2 , solute carrier family 22 (organic cation transporter) |
| Synonyms: |
OCT2 |
| Synonyms name: |
organic cation transporter 2 |
| Locus: |
6q25, 3 |
| Discovery year: |
1998-01-20 |
| GenBank acession: |
X98333 |
| Entrez gene record: |
6582 |
| Pubmed identfication: |
9605850 |
| RefSeq identity: |
NM_003058 |
| Classification: |
Solute carriers |
| Havana BLAST/BLAT: |
OTTHUMG00000015950 |