SLC22A2 Antibody

Contact us
Catalog number: R31806
Price: 406 €
Supplier: NJS poly
Product name: SLC22A2 Antibody
Quantity: 0.1mg
Other quantities: 1 vial 440€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SLC22A2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
Notes: Optimal dilution of the SLC22A2 antibody should be determined by the researcher
Intented use: This SLC22A2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15244
Purity: Antigen affinity
Description: It is found primarily in the kidney, It is mapped to 6q25, Polyspecific organic cation transporters in the liver, The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein, This gene is one of three similar cation transporter genes located in a cluster on chromosome 6, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins, intestine, kidney, where it may mediate the first step in cation reabsorption, 3, SLC22A2 is also known as OCT2
Immunogen: Amino acids ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN of human SLC22A2 were used as the immunogen for the SLC22A2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLC22A2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SLC22A2
Short name: SLC22A2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SLC22A2 (Antibody to)
Alternative technique: antibodies
Identity: 10966
Gene: SLC22A2 | More about : SLC22A2
Long gene name: solute carrier family 22 member 2
Synonyms gene name: member 2 , solute carrier family 22 (organic cation transporter)
Synonyms: OCT2
Synonyms name: organic cation transporter 2
Locus: 6q25, 3
Discovery year: 1998-01-20
GenBank acession: X98333
Entrez gene record: 6582
Pubmed identfication: 9605850
RefSeq identity: NM_003058
Classification: Solute carriers
Havana BLAST/BLAT: OTTHUMG00000015950

Related Products :