TPP1 Antibody

Contact us
Catalog number: R31801
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: TPP1 Antibody
Quantity: 0.1ml
Other quantities: 0.1mg 406€ 0.1ml 263€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TPP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the TPP1 antibody should be determined by the researcher
Intented use: This TPP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O14773
Purity: Antigen affinity
Description: It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification, Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, This gene encodes a member of the sedolisin family of serine proteases, also known as Lysosomal pepstatin-insensitive protease, and has weaker endopeptidase activity, is an enzyme that in humans is encoded by the TPP1 gene, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome, Tripeptidyl-peptidase 1
Immunogen: Amino acids CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV of human TPP1 were used as the immunogen for the TPP1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TPP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TPP1
Short name: TPP1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TPP1 (Antibody to)
Alternative technique: antibodies
Identity: 2073
Gene: TPP1 | More about : TPP1
Long gene name: tripeptidyl peptidase 1
Synonyms gene: CLN2 SCAR7
Synonyms gene name: autosomal recessive 7 tripeptidyl peptidase I , ceroid-lipofuscinosis, late infantile (Jansky-Bielschowsky disease) spinocerebellar ataxia, neuronal 2
Synonyms name: TPP I
Locus: 11p15, 4
Discovery year: 1990-01-30
GenBank acession: AF017456
Entrez gene record: 1200
Pubmed identfication: 9653647 23418007
Havana BLAST/BLAT: OTTHUMG00000133404
Locus Specific Databases: NCL Mutations LRG_830 , Neuronal Ceroid Lipofuscinoses

Related Products :

GENTAUR-58bdf1733dcc5 Anti- TPP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf173a0617 Anti- TPP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4209edb3c Anti- TPP1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be51ca36852 Anti- TPP1 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be51ca8591c Anti- TPP1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be51cae4269 Anti- TPP1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be552180c26 Anti- TPP1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be5521dccd4 Anti- TPP1 Antibody 100ug 387 € MBS Polyclonals human
abx145299 Anti-TPP1 Antibody inquire 50 € abbex human
abx149403 Anti-TPP1 Antibody 100 μg 311 € abbex human
MBS421707 Goat anti-CLN2 / TPP1 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58bde7bc2c8c6 Mouse Monoclonal [clone 3B1] (IgG1,k) to Human TPP1 / CLN2 Antibody 50ug 663 € MBS mono human
MBS276773 TPP1 antibody 100ul 426 € MBS Polyclonals_1 human
R31801 TPP1 Antibody 0.1mg 406 € NJS poly human
R36250-100UG TPP1 Antibody 0.1mg 406 € NJS poly human
bs-8528R-A350 TPP1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8528R-A488 TPP1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8528R-A555 TPP1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8528R-A594 TPP1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8528R-A647 TPP1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
BIN-001200-B01 TPP1 Antibody (B01) 0.05ml 495 € Zyagen human
BIN-001200-B01P TPP1 Antibody (B01P) 0.05mg 495 € Zyagen human
bs-8528R-Biotin TPP1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8528R TPP1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-8528R-Cy3 TPP1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8528R-Cy5 TPP1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8528R-Cy5.5 TPP1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8528R-Cy7 TPP1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8528R-FITC TPP1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8528R-HRP TPP1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human