| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TPP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the TPP1 antibody should be determined by the researcher |
| Intented use: |
This TPP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O14773 |
| Purity: |
Antigen affinity |
| Description: |
It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification, Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, This gene encodes a member of the sedolisin family of serine proteases, also known as Lysosomal pepstatin-insensitive protease, and has weaker endopeptidase activity, is an enzyme that in humans is encoded by the TPP1 gene, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome, Tripeptidyl-peptidase 1 |
| Immunogen: |
Amino acids CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV of human TPP1 were used as the immunogen for the TPP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TPP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TPP1 |
| Short name: |
TPP1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TPP1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2073 |
| Gene: |
TPP1 |
More about : TPP1 |
| Long gene name: |
tripeptidyl peptidase 1 |
| Synonyms gene: |
CLN2 SCAR7 |
| Synonyms gene name: |
autosomal recessive 7 tripeptidyl peptidase I , ceroid-lipofuscinosis, late infantile (Jansky-Bielschowsky disease) spinocerebellar ataxia, neuronal 2 |
| Synonyms name: |
TPP I |
| Locus: |
11p15, 4 |
| Discovery year: |
1990-01-30 |
| GenBank acession: |
AF017456 |
| Entrez gene record: |
1200 |
| Pubmed identfication: |
9653647 23418007 |
| Havana BLAST/BLAT: |
OTTHUMG00000133404 |
| Locus Specific Databases: |
NCL Mutations LRG_830 , Neuronal Ceroid Lipofuscinoses |