Galectin 9 Antibody

Contact us
Catalog number: R31782
Price: 558 €
Supplier: acr
Product name: Galectin 9 Antibody
Quantity: 0,1 ml
Other quantities: 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Galectin 9
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the Galectin 9 antibody should be determined by the researcher
Intented use: This Galectin 9 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00182
Purity: Antigen affinity
Description: It is mapped to 17q11, It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&, Multiple alternatively spliced transcript variants have been found for this gene, The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions, The protein encoded by this gene is an S-type lectin, 2, Galectin-9 is a protein that in humans is encoded by the LGALS9 gene, RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency
Immunogen: Amino acids DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT of human Galectin 9 were used as the immunogen for the Galectin 9 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Galectin 9 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Galectin 9
Short name: Galectin 9 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Galectin 9 (Antibody to)
Alternative technique: antibodies
Identity: 6570
Gene: LGALS9 | More about : LGALS9
Long gene name: galectin 9
Synonyms gene name: 9 , galactoside-binding, lectin, soluble
Synonyms: LGALS9A
Locus: 17q11, 2
Discovery year: 1997-06-25
GenBank acession: AB006782
Entrez gene record: 3965
Pubmed identfication: 9045665
RefSeq identity: NM_009587
Classification: Galectins
Havana BLAST/BLAT: OTTHUMG00000179831

Related Products :

MEDCLA780 CD44v6, Clone: VFF-7, Mouse Monoclonal antibody-Human, + Galectin-3, Clone: 9C4, Mouse Monoclonal antibody-Human, Antibody Set for IH set Ask price € accurate-monoclonals human
GWB-6F6392 antibody to or anti- Galectin-1 antibody 1 tube 845 € genways human
GWB-880F73 antibody to or anti- Galectin-1 Human -biotin conjugated antibody 1 vial 602 € genways human
GWB-A4226E Galectin-3 (LGALS3) Rabbit antibody to or anti-Mouse Polyclonal (aa151-251) antibody 1 vial 602 € genways mouse
AR09268PU-L anti-Galectin-1 (1-135) Antibody 0,5 mg 833 € acr human
AR09268PU-N anti-Galectin-1 (1-135) Antibody 0,1 mg 384 € acr human
AR50602PU-N anti-Galectin-1 (1-135, His-tag) Antibody 0,5 mg 1109 € acr human
AR50602PU-S anti-Galectin-1 (1-135, His-tag) Antibody 0,1 mg 485 € acr human
AM11026SU-N anti-Galectin-1 Antibody 0,1 ml 587 € acr human
AP00267PU-N anti-Galectin-1 Antibody 0,1 mg 587 € acr human
AP51860PU-N anti-Galectin-1 Antibody 0,4 ml 587 € acr human
AR31162PU-N anti-Galectin-1 Antibody 50 Вµg 442 € acr human
BB-PA1422 anti-Galectin-1 Antibody 0,1 mg 471 € acr human
CPA1678-100ul anti-Galectin-1 Antibody 0,1 ml 442 € acr human
CPA1678-200ul anti-Galectin-1 Antibody 0,2 ml 688 € acr human
CPA1678-30ul anti-Galectin-1 Antibody 30 Вµl 326 € acr human
DM3545P anti-Galectin-1 Antibody 0,1 mg 688 € acr human
GENTAUR-58be08bd93bf0 Anti- Galectin 1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be08bdf197e Anti- Galectin 1 Antibody 0.06 ml 265 € MBS Polyclonals human
PA227 anti-Galectin-1 Antibody 10 Вµg 253 € acr human
PA227X anti-Galectin-1 Antibody 50 Вµg 384 € acr human
PP1223B1 anti-Galectin-1 Antibody 25 Вµg 384 € acr human
PP1223B2 anti-Galectin-1 Antibody 50 Вµg 543 € acr human
PP1223P1 anti-Galectin-1 Antibody 50 Вµg 369 € acr human
PP1223P2 anti-Galectin-1 Antibody 0,1 mg 529 € acr human
abx129970 Anti-Galectin 1 Antibody 100 μg 557 € abbex human
abx130429 Anti-Galectin 1 Antibody 10 μg 296 € abbex human
AM33389PU-M anti-Galectin-1 (C-term) Antibody 0,5 ml 862 € acr human
AM33389PU-N anti-Galectin-1 (C-term) Antibody 1 ml 1239 € acr human
AM33389PU-S anti-Galectin-1 (C-term) Antibody 0,1 ml 558 € acr human