| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Galectin 9 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Galectin 9 antibody should be determined by the researcher |
| Intented use: |
This Galectin 9 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O00182 |
| Purity: |
Antigen affinity |
| Description: |
It is mapped to 17q11, It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&, Multiple alternatively spliced transcript variants have been found for this gene, The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions, The protein encoded by this gene is an S-type lectin, 2, Galectin-9 is a protein that in humans is encoded by the LGALS9 gene, RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency |
| Immunogen: |
Amino acids DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT of human Galectin 9 were used as the immunogen for the Galectin 9 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Galectin 9 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Galectin 9 |
| Short name: |
Galectin 9 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Galectin 9 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
6570 |
| Gene: |
LGALS9 |
More about : LGALS9 |
| Long gene name: |
galectin 9 |
| Synonyms gene name: |
9 , galactoside-binding, lectin, soluble |
| Synonyms: |
LGALS9A |
| Locus: |
17q11, 2 |
| Discovery year: |
1997-06-25 |
| GenBank acession: |
AB006782 |
| Entrez gene record: |
3965 |
| Pubmed identfication: |
9045665 |
| RefSeq identity: |
NM_009587 |
| Classification: |
Galectins |
| Havana BLAST/BLAT: |
OTTHUMG00000179831 |