RUNX1 Antibody (AML1)

Contact us
Catalog number: R31576
Price: 819 €
Supplier: acr
Product name: RUNX1 Antibody (AML1)
Quantity: 50 Вµg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RUNX1 (AML1)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts
Intented use: This RUNX1 antibodyis to be used only for research purposes and not for diagnostics
Gene ID #: 861
Purity: Antigen affinity
Description: Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML, It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa), Mutations are implicated in cases of breast cancer, RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex, RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene, Runt-related transcription factor 1
Immunogen: mouse and rat), An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RUNX1 antibody can be stored for up to one month at 4oC, After reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RUNX1 (AML1)
Short name: RUNX1 Antibody (AML1)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: runt-related transcription factor 1 (Antibody to) (AML1)
Alternative technique: antibodies
Alternative to gene target: AML1 and AML1-EVI-1 and AMLCR1 and CBFA2 and EVI-1 and PEBP2aB, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007417 and central nervous system development and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0009966 and regulation of signal transduction and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030099 and myeloid cell differentiation and biological process this GO :0030182 and neuron differentiation and biological process this GO :0030853 and negative regulation of granulocyte differentiation and biological process this GO :0030854 and positive regulation of granulocyte differentiation and biological process this GO :0031069 and hair follicle morphogenesis and biological process this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048266 and behavioral response to pain and biological process this GO :0048666 and neuron development and biological process this GO :0048935 and peripheral nervous system neuron development and biological process this GO :0060216 and definitive hemopoiesis and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :0071336 and regulation of hair follicle cell proliferation and biological process this GO :0071425 and hematopoietic stem cell proliferation and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, RUNX1 and IDBG-2825 and ENSG00000159216 and 100506403, RUNX1 and IDBG-640443 and ENSBTAG00000004742 and 529631, Runx1 and IDBG-177713 and ENSMUSG00000022952 and 12394, nuclei, repressing transcription factor binding, this GO :0000975 and regulatory region DNA binding and molecular function this GO :0001501 and skeletal system development and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001889 and liver development and biological process this GO :0002318 and myeloid progenitor cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005604 and basement membrane and cellular component this GO :0005634 and nucleus and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0008134 : transcription factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0070491 : repressing transcription factor binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0008134 : transcription factor binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0070491 : repressing transcription factor binding, 861, 101928269, runt-related transcription factor 1
Identity: 10471
Gene: RUNX1 | More about : RUNX1
Long gene name: runt related transcription factor 1
Synonyms gene: AML1 CBFA2
Synonyms gene name: acute myeloid leukemia 1 runt-related transcription factor 1
Synonyms: PEBP2A2 AMLCR1
Synonyms name: aml1 oncogene
Locus: 21q22, 12
Discovery year: 1991-08-20
GenBank acession: X79549
Entrez gene record: 861
Pubmed identfication: 1427868 7835892
Havana BLAST/BLAT: OTTHUMG00000086299
Locus Specific Databases: LRG_482

Related Products :

RUNX1-101AP anti-RUNX1 / AML1 Antibody 100 µg 357 € fabgen human
RUNX1-BIOTIN anti-RUNX1 / AML1 Antibody BIOTIN 100 µg 456 € fabgen human
RUNX1-FITC anti-RUNX1 / AML1 Antibody FITC 100 µg 456 € fabgen human
GENTAUR-58bde842aae06 Mouse Monoclonal [clone 2B5] (IgG1) to Human AML1 / RUNX1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde81ddfa0c Mouse Monoclonal [clone 2C10] (IgG2a,k) to Human AML1 / RUNX1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde6e8cb3be Mouse Monoclonal [clone 3A1] (IgG2b,k) to Human AML1 / RUNX1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde810d395e Mouse Monoclonal [clone 3A8] (IgG2b,k) to Human AML1 / RUNX1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde7a5c2cce Mouse Monoclonal [clone 4E7] (IgG2b,k) to Human AML1 / RUNX1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde838a9bd5 Mouse Monoclonal [clone 5A1] (IgG1) to Human AML1 / RUNX1 Antibody 0.05 ml 597 € MBS mono human
R31576 RUNX1 Antibody (AML1) 0.1mg 406 € NJS poly human
P-RUNX1 RUNX1 / AML1 Blocking Peptide sequence 100 µg 218 € fabgen human
PC-RUNX1 RUNX1 / AML1 Positive Controlfor Western Blot 100 µg 264 € fabgen human
MAB080 Amylase, Clone: A1312.1/AML1, Mouse Monoclonal antibody-Human; frozen, ELISA/IH 1 mg Ask price € accurate-monoclonals human
A03A0186 anti-AML1 (Ab-435) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58be477995cda Anti- AML1 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be47e736bcb Anti- AML1 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be4928289d6 Anti- AML1 Antibody 100ug 370 € MBS Polyclonals human
A03A0187 anti-AML1 (Phospho-Ser435) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
MBS422330 Goat anti-EVI1 / AML1 Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-ASC121 Human AML1 (Ab-276) Antibody bulk Ask price € genways bulk human
GWB-ASC122 Human AML1 (Ab-303) Antibody bulk Ask price € genways bulk human
GWB-ASC955 Human AML1 (Ab-435) Antibody bulk Ask price € genways bulk human
GWB-ASB088 Human AML1 (Phospho-Ser276) Antibody bulk Ask price € genways bulk human
GWB-ASB089 Human AML1 (Phospho-Ser303) Antibody bulk Ask price € genways bulk human
GWB-ASB965 Human AML1 (Phospho-Ser435) Antibody bulk Ask price € genways bulk human
AM31152PU-N anti-RUNX1 (210-311) Antibody 50 Вµg 819 € acr human
AM06583SU-N anti-RUNX1 Antibody 0,1 ml 674 € acr human
AM06605SU-N anti-RUNX1 Antibody 0,1 ml 674 € acr human
AM31150PU-N anti-RUNX1 Antibody 50 Вµg 819 € acr human
AM31151PU-N anti-RUNX1 Antibody 50 Вµg 819 € acr human