| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RUNX1 (AML1) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This RUNX1 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
861 |
| Purity: |
Antigen affinity |
| Description: |
Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML, It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa), Mutations are implicated in cases of breast cancer, RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex, RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene, Runt-related transcription factor 1 |
| Immunogen: |
mouse and rat), An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RUNX1 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RUNX1 (AML1) |
| Short name: |
RUNX1 Antibody (AML1) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
runt-related transcription factor 1 (Antibody to) (AML1) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AML1 and AML1-EVI-1 and AMLCR1 and CBFA2 and EVI-1 and PEBP2aB, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007417 and central nervous system development and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0009966 and regulation of signal transduction and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030099 and myeloid cell differentiation and biological process this GO :0030182 and neuron differentiation and biological process this GO :0030853 and negative regulation of granulocyte differentiation and biological process this GO :0030854 and positive regulation of granulocyte differentiation and biological process this GO :0031069 and hair follicle morphogenesis and biological process this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048266 and behavioral response to pain and biological process this GO :0048666 and neuron development and biological process this GO :0048935 and peripheral nervous system neuron development and biological process this GO :0060216 and definitive hemopoiesis and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :0071336 and regulation of hair follicle cell proliferation and biological process this GO :0071425 and hematopoietic stem cell proliferation and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, RUNX1 and IDBG-2825 and ENSG00000159216 and 100506403, RUNX1 and IDBG-640443 and ENSBTAG00000004742 and 529631, Runx1 and IDBG-177713 and ENSMUSG00000022952 and 12394, nuclei, repressing transcription factor binding, this GO :0000975 and regulatory region DNA binding and molecular function this GO :0001501 and skeletal system development and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001889 and liver development and biological process this GO :0002318 and myeloid progenitor cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005604 and basement membrane and cellular component this GO :0005634 and nucleus and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0008134 : transcription factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0070491 : repressing transcription factor binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0008134 : transcription factor binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0070491 : repressing transcription factor binding, 861, 101928269, runt-related transcription factor 1 |
| Identity: |
10471 |
| Gene: |
RUNX1 |
More about : RUNX1 |
| Long gene name: |
runt related transcription factor 1 |
| Synonyms gene: |
AML1 CBFA2 |
| Synonyms gene name: |
acute myeloid leukemia 1 runt-related transcription factor 1 |
| Synonyms: |
PEBP2A2 AMLCR1 |
| Synonyms name: |
aml1 oncogene |
| Locus: |
21q22, 12 |
| Discovery year: |
1991-08-20 |
| GenBank acession: |
X79549 |
| Entrez gene record: |
861 |
| Pubmed identfication: |
1427868 7835892 |
| Havana BLAST/BLAT: |
OTTHUMG00000086299 |
| Locus Specific Databases: |
LRG_482 |