Bmi1 Antibody

Contact us
Catalog number: R31554
Price: 406 €
Supplier: NJS poly
Product name: Bmi1 Antibody
Quantity: 0.1mg
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.1ml 263€ 0.4 ml 406€ 1 vial 521€ 100ug 370€ 50ug 299€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Bmi1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Notes: Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts
Intented use: This Bmi1 antibodyis to be used only for research purposes and not for diagnostics
Gene ID #: 648
Purity: Antigen affinity
Description: BMI1 selectively extended the life span of these cultures, By fluorescence in situ hybridization, Complementation studies showed that the protein completely rescues these proliferative defects, Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells, Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4), It has a key role in regulating the proliferative activity of normal stem and progenitor cells, Most importantly, The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene, leading to transplant failure of the leukemia, the human gene is assigned to chromosome 10p13, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, B lymphoma Mo MLV insertion region 1
Immunogen: An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Bmi1 antibody can be stored for up to one month at 4oC, After reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Bmi1
Short name: Bmi1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Bmi1 (Antibody to)
Alternative technique: antibodies
Identity: 51428
Gene: BMI1P1 | More about : BMI1P1
Long gene name: BMI1 proto-oncogene, polycomb ring finger pseudogene 1
Locus: Xq12
Discovery year: 2014-11-21
Entrez gene record: 100127902
RefSeq identity: NG_011910
Havana BLAST/BLAT: OTTHUMG00000021739

Related Products :

GWB-F581C0 antibody to or anti-Bmi1 antibody 1 vial 667 € genways human
GWB-75B9B9 DNA-binding protein Bmi-1 (BMI1) Goat antibody to or anti-Human Polyclonal (aa252-264) antibody 1 tube 648 € genways human
GENTAUR-58bdf2762d7e4 Anti- BMI1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf276a62d8 Anti- BMI1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf552d9ac3 Anti- BMI1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf55344ee9 Anti- BMI1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3cde7bec8 Anti- BMI1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be42013a1b8 Anti- Bmi1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be467f5d0de Anti- BMI1 Antibody 100ug 393 € MBS Polyclonals human
abx148646 Anti-BMI1 Antibody 200 μg 369 € abbex human
abx225064 Anti-BMI1 Antibody 50 μl 325 € abbex human
bsm-51081M BMI1 (282CT3.7.6) Monoclonal Antibody 0.1ml 328 € Bioss Primary Unconjugated Antibodies human
bsm-51082M BMI1 (282CT3.7.6) Monoclonal Antibody 0.1ml 211 € Bioss Primary Unconjugated Antibodies human
F48074-0.08ML BMI1 Antibody 0.08 ml 199 € NJS poly human
F48074-0.4ML BMI1 Antibody 0.4 ml 406 € NJS poly human
F51332-0.08ML BMI1 Antibody 0.08 ml 199 € NJS poly human
F51332-0.4ML BMI1 Antibody 0.4 ml 406 € NJS poly human
F53353-0.08ML BMI1 Antibody 0.08 ml 199 € NJS poly human
F53353-0.4ML BMI1 Antibody 0.4 ml 406 € NJS poly human
F53430-0.08ML Bmi1 Antibody 0.08 ml 199 € NJS poly human
F53430-0.4ML Bmi1 Antibody 0.4 ml 406 € NJS poly human
F53468-0.08ML Bmi1 Antibody 0.08 ml 199 € NJS poly human
F53468-0.4ML Bmi1 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be49e4c1d63 Bmi1 Antibody 50ug 299 € MBS mono human
GENTAUR-58be49e52aa98 Bmi1 Antibody 100ug 370 € MBS mono human
GENTAUR-58be4c5fe6013 BMI1 Antibody 100ug 370 € MBS mono human
GWB-ML655G Bmi1 antibody 1 vial 521 € genways human
R30905 Bmi1 Antibody 0.1mg 389 € NJS poly human
R31554 Bmi1 Antibody 0.1mg 406 € NJS poly human
R34820-100UG BMI1 Antibody 0.1mg 406 € NJS poly human