| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Bmi1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Notes: |
Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This Bmi1 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
648 |
| Purity: |
Antigen affinity |
| Description: |
BMI1 selectively extended the life span of these cultures, By fluorescence in situ hybridization, Complementation studies showed that the protein completely rescues these proliferative defects, Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells, Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4), It has a key role in regulating the proliferative activity of normal stem and progenitor cells, Most importantly, The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene, leading to transplant failure of the leukemia, the human gene is assigned to chromosome 10p13, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, B lymphoma Mo MLV insertion region 1 |
| Immunogen: |
An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Bmi1 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Bmi1 |
| Short name: |
Bmi1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Bmi1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
51428 |
| Gene: |
BMI1P1 |
More about : BMI1P1 |
| Long gene name: |
BMI1 proto-oncogene, polycomb ring finger pseudogene 1 |
| Locus: |
Xq12 |
| Discovery year: |
2014-11-21 |
| Entrez gene record: |
100127902 |
| RefSeq identity: |
NG_011910 |
| Havana BLAST/BLAT: |
OTTHUMG00000021739 |