| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ATP2A2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This ATP2A2 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
488 |
| Purity: |
Antigen affinity |
| Description: |
In Darier disease skin, SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes, SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, SERCA2 was expressed in all specimens, The SERCA2 gene is mapped to 12q24, There was variable suprabasal expression, They are closely related to the plasma membrane Ca(2+)-ATPases, also called ATP2A2 or ATP2B, and acantholytic lesional cells, and arrector pili muscle, apocrine gland cells, encodes one of the SERCA Ca(2+)-ATPases, germinative and mature cells of sebaceous glands, or PMCAs, secretory coil and duct of eccrine glands, strong SERCA2 positivity was detected in the basal, suprabasal, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes, 11, SERCA2 |
| Immunogen: |
An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ATP2A2 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ATP2A2 |
| Short name: |
ATP2A2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Ca+and transporting, cardiac muscle, slow twitch 2 (Antibody to), ATPase |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
ATP2A2 and IDBG-56943 and ENSG00000174437 and 488, ATP2A2 and IDBG-633099 and ENSBTAG00000001398 and 540568, ATP2B and DAR and DD and SERCA2, Atp2a2 and IDBG-198239 and ENSMUSG00000029467 and 11938, Ca++ transporting, Plasma membranes, calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, cardiac muscle, slow twitch 2, this GO :0000166 and nucleotide binding and molecular function this GO :0002026 and regulation of the force of heart contraction and biological process this GO :0005388 and calcium-transporting ATPase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006810 and transport and biological process this GO :0006812 and cation transport and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006984 and ER-nucleus signaling pathway and biological process this GO :0007155 and cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0008022 and protein C-terminus binding and molecular function this GO :0008152 and metabolic process and biological process this GO :0008544 and epidermis development and biological process this GO :0010460 and positive regulation of heart rate and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016529 and sarcoplasmic reticulum and cellular component this GO :0019829 and cation-transporting ATPase activity and molecular function this GO :0019899 and enzyme binding and molecular function this GO :0031095 and platelet dense tubular network membrane and cellular component this GO :0033017 and sarcoplasmic reticulum membrane and cellular component this GO :0034220 and ion transmembrane transport and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0044548 and S100 protein binding and molecular function this GO :0045822 and negative regulation of heart contraction and biological process this GO :0046872 and metal ion binding and molecular function this GO :0055085 and transmembrane transport and biological process this GO :0055119 and relaxation of cardiac muscle and biological process this GO :0070296 and sarcoplasmic reticulum calcium ion transport and biological process this GO :0070588 and calcium ion transmembrane transport and biological process this GO :0086036 and regulation of cardiac muscle cell membrane potential and biological process this GO :0086039 and calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential and molecular function, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0005388 : calcium-transporting ATPase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0008022 : protein C-terminus binding and also this GO :0019829 : cation-transporting ATPase activity and also this GO :0019899 : enzyme binding and also this GO :0044548 : S100 protein binding and also this GO :0046872 : metal ion binding and also this GO :0086039 : calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, this GO :0005388 : calcium-transporting ATPase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0008022 : protein C-terminus binding, this GO :0019829 : cation-transporting ATPase activity, this GO :0019899 : enzyme binding, this GO :0044548 : S100 protein binding, this GO :0046872 : metal ion binding, this GO :0086039 : calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential, ATPase |
| Identity: |
812 |
| Gene: |
ATP2A2 |
More about : ATP2A2 |
| Long gene name: |
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 |
| Synonyms gene: |
ATP2B DAR |
| Synonyms gene name: |
ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 |
| Synonyms: |
SERCA2 |
| Synonyms name: |
sarcoplasmic/endoplasmic reticulum calcium ATPase 2 calcium pump 2 |
| Locus: |
12q24, 11 |
| Discovery year: |
1990-09-10 |
| Entrez gene record: |
488 |
| Pubmed identfication: |
10080178 |
| RefSeq identity: |
NM_001681 |
| Classification: |
ATPases Ca2+ transporting |
| Havana BLAST/BLAT: |
OTTHUMG00000169327 |