| Reacts with: |
cerevisiae, S |
| Source: |
proteins, Recombinants or rec |
| Description: |
cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM14 is produced by our E, Recombinant S, coli expression system and the target gene encoding Phe99-Lys168 is expressed |
| Molecular Weight: |
7, 9 kD |
| UniProt number: |
Q07914 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM Tris, 300 mM sodium chloride, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
cerevisiae TIM14, S |
| Short name: |
cerevisiae TIM14, Recombinant S |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name: |
cerevisiae TIM14, recombinant S |
| Alternative technique: |
rec |
| Identity: |
30528 |
| Gene: |
DNAJC19 |
More about : DNAJC19 |
| Long gene name: |
DnaJ heat shock protein family (Hsp40) member C19 |
| Synonyms gene name: |
DnaJ (Hsp40) homolog, member 19 , subfamily C |
| Synonyms: |
TIMM14 Tim14 Pam18 |
| Locus: |
3q26, 33 |
| Discovery year: |
2005-07-28 |
| Entrez gene record: |
131118 |
| Pubmed identfication: |
19564938 |
| RefSeq identity: |
NM_145261 |
| Classification: |
DNAJ (HSP40) heat shock proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000158180 |
| Locus Specific Databases: |
LRG_743 |