Recombinant Human Nucleobindin-2, Nesfatin-1

Contact us
Catalog number: CR25
Price: 921 €
Supplier: DL elisas
Product name: Recombinant Human Nucleobindin-2, Nesfatin-1
Quantity: 96T
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Nucleobindin-2 is produced by our E, coli expression system and the target gene encoding Val25-Leu106 is expressed
Molecular Weight: 6 kD, 9
UniProt number: P80303
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 10 mM Sodium Phosphate, 5, Lyophilized from a 0, pH6
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Nesfatin-1, Nucleobindin-2
Short name: Nesfatin-1, Recombinant Nucleobindin-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Nesfatin-1, sapiens Nucleobindin-2, recombinant H
Alternative technique: rec

Related Products :

CR25 Recombinant Human Nucleobindin-2, Nesfatin-1 50 µg 496 € novo human
abx262601 Anti-Nucleobindin-2, His Tag Protein (Recombinant) 1 mg 6662 € abbex human
abx167491 Anti-Nucleobindin 2 Protein (Recombinant) 100 μg 920 € abbex human
abx261714 Anti-Nucleobindin-2 Protein (Recombinant) 5 µg 238 € abbex human
abx263172 Anti-Nucleobindin-2 Protein (Recombinant) 20 µg 238 € abbex human
GWB-A0B0D4 Recombinant Mouse Nucleobindin-2 bulk Ask price € genways bulk mouse
GWB-BIG0E4 Recombinant Human Nesfatin-1 bulk Ask price € genways bulk human
ZR-40-545 Nesfatin-1 Recombinant Protein 0.002 mg 256 € Zyagen human
abx253711 Anti-Human Nucleobindin-2 ELISA Kit inquire 50 € abbex human
MBS248548 PAb (IgG) to Human NUCB2 / Nucleobindin 2 Antibody 50ug 597 € MBS Polyclonals_1 human
abx154481 Anti-Mouse Nucleobindin 1 ELISA Kit 96 tests 949 € abbex mouse
abx571516 Anti-Mouse Nucleobindin 1 (NUCB1) ELISA Kit 96 tests 804 € abbex mouse
abx254702 Anti-Mouse Nucleobindin-2 ELISA Kit inquire 50 € abbex mouse
AR09062PU-L anti-Nucleobindin-2 (25-420, His-tag) Antibody 0,5 mg 1138 € acr human
AR09062PU-N anti-Nucleobindin-2 (25-420, His-tag) Antibody 0,1 mg 485 € acr human
abx129695 Anti-Nucleobindin 2 Antibody 100 μg 528 € abbex human
GENTAUR-58bdc54fe3a56 Anti- Nucleobindin 2 (NUCB2) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc5504884f Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc9c9bb3a4 Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc9ca5484e Anti- Nucleobindin 2 (NUCB2) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcd7ebb77a Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd29750717 Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddc3b989f8 Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddd3f62209 Anti- Nucleobindin 2 (NUCB2) Antibody 100ug 564 € MBS Polyclonals human
abx155922 Anti-Rat Nucleobindin 1 ELISA Kit 96 tests 992 € abbex rat
abx571666 Anti-Rat Nucleobindin 1 (NUCB1) ELISA Kit inquire 50 € abbex rat
abx155923 Anti-Rat Nucleobindin 2 ELISA Kit 96 tests 992 € abbex rat
abx256228 Anti-Rat Nucleobindin-2 ELISA Kit inquire 50 € abbex rat
abx573046 Anti-Rat Nucleobindin 2 (NUCB2) ELISA Kit 96 tests 833 € abbex rat
DL-NUCB1-Mu Mouse Nucleobindin 1 NUCB1 ELISA Kit 96T 921 € DL elisas mouse