Recombinant Human Retinoid-Binding Protein 7

Contact us
Catalog number: CR20
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Retinoid-Binding Protein 7
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Retinoid-binding Protein 7 is produced by our E, coli expression system and the target gene encoding Met1-Ala134 is expressed
Molecular Weight: 15, 5 kD
UniProt number: Q96R05
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Retinoid-Binding Protein 7
Short name: Recombinant Retinoid-Binding Protein 7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Retinoid-Binding Protein 7, recombinant H
Alternative technique: rec

Related Products :

CR20 Recombinant Human Retinoid-Binding Protein 7 50 µg 303 € novo human
RP-1588 Recombinant (E.Coli) Human Retinoid X Receptor Alpha 10 μg 260 € adi human
abx260438 Anti-Retinoid X Receptor alpha Protein (Recombinant) 50 µg 340 € abbex human
GWB-P0061I RXR-alpha( Retinoid x receptor;111-228aa, Recombinant Protein bulk Ask price € genways bulk human
AR09876PU-L anti-Retinoid-binding protein 7 / RBP7 (1-134, His-tag) Antibody 0,5 mg 1138 € acr human
AR09876PU-N anti-Retinoid-binding protein 7 / RBP7 (1-134, His-tag) Antibody 0,1 mg 485 € acr human
GWB-E446F7 Interphotoreceptor Retinoid Binding Protein Fragment bulk Ask price € genways bulk human
MBS619375 RAP80, CT (Receptor Associated Protein 80, Receptor-associated Protein 80, Nuclear Zinc Finger Protein RAP80, Retinoid X Receptor-interacting Protein, Retinoid X Receptor-interacting Protein 110, RIP110, Rxrip110, Ubiquitin Interaction Motif-containing 1, Antibody 100ug 558 € MBS Polyclonals_1 human
abx251887 Anti-Human Retinoid isomerohydrolase ELISA Kit inquire 50 € abbex human
abx573102 Anti-Human Retinoid X Receptor Alpha (RXRa) ELISA Kit inquire 50 € abbex human
abx571902 Anti-Human Retinoid X Receptor Gamma (RXRg) ELISA Kit inquire 50 € abbex human
DL-RXRa-Hu Human Retinoid X Receptor Alpha RXRa ELISA Kit 96T 904 € DL elisas human
GWB-ASD186 Human Retinoid X Receptor gamma Antibody bulk Ask price € genways bulk human
DL-RXRg-Hu Human Retinoid X Receptor Gamma RXRg ELISA Kit 96T 904 € DL elisas human
GWB-782D32 Retinoid-Related Orphan Receptor Gamma (RORC) Rabbit antibody to or anti-Human Polyclonal (aa1-50) antibody 1 tube 602 € genways human
GWB-E818DE Retinoid X Receptor Alpha (RXRA) Rabbit antibody to or anti-Human Polyclonal (pSer61) antibody 1 vial 602 € genways human
GENTAUR-58be5beaa2f08 Anti-RAI1/Retinoid acid induced protein 1, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-11940R-A350 RAI1/Retinoid acid induced protein 1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11940R-A488 RAI1/Retinoid acid induced protein 1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11940R-A555 RAI1/Retinoid acid induced protein 1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11940R-A594 RAI1/Retinoid acid induced protein 1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11940R-A647 RAI1/Retinoid acid induced protein 1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11940R-Biotin RAI1/Retinoid acid induced protein 1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11940R RAI1/Retinoid acid induced protein 1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11940R-Cy3 RAI1/Retinoid acid induced protein 1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11940R-Cy5 RAI1/Retinoid acid induced protein 1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11940R-Cy5.5 RAI1/Retinoid acid induced protein 1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11940R-Cy7 RAI1/Retinoid acid induced protein 1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11940R-FITC RAI1/Retinoid acid induced protein 1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11940R-HRP RAI1/Retinoid acid induced protein 1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human