Recombinant Human Fibroblast growth factor 10, FGF10

Contact us
Catalog number: CR11
Price: 1277 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Fibroblast growth factor 10, FGF10
Quantity: 100ul
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Complex subunit associated factors are involved in hybridoma growth, Eosinohils, NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation, Aplha
Molecular Weight: 19, 5 kD
UniProt number: O15520
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM Tris, 200 mM sodium chloride, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FGF10, Fibroblast growth factor 10
Short name: FGF10, Recombinant Fibroblast growth factor 10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: fibroblast growth factor 10, sapiens Fibroblast growth factor 10, recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0046877 and regulation of saliva secretion and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048514 and blood vessel morphogenesis and biological process this GO :0048536 and spleen development and biological process this GO :0048538 and thymus development and biological process this GO :0048557 and embryonic digestive tract morphogenesis and biological process this GO :0048565 and digestive tract development and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048645 and organ formation and biological process this GO :0048730 and epidermis morphogenesis and biological process this GO :0048752 and semicircular canal morphogenesis and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0048807 and female genitalia morphogenesis and biological process this GO :0048808 and male genitalia morphogenesis and biological process this GO :0050671 and positive regulation of lymphocyte proliferation and biological process this GO :0050673 and epithelial cell proliferation and biological process this GO :0050674 and urothelial cell proliferation and biological process this GO :0050677 and positive regulation of urothelial cell proliferation and biological process this GO :0050678 and regulation of epithelial cell proliferation and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050872 and white fat cell differentiation and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051145 and smooth muscle cell differentiation and biological process this GO :0051549 and positive regulation of keratinocyte migration and biological process this GO :0060019 and radial glial cell differentiation and biological process this GO :0060054 and positive regulation of epithelial cell proliferation involved in wound healing and biological process this GO :0060173 and limb development and biological process this GO :0060174 and limb bud formation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060428 and lung epithelium development and biological process this GO :0060430 and lung saccule development and biological process this GO :0060436 and bronchiole morphogenesis and biological process this GO :0060441 and epithelial tube branching involved in lung morphogenesis and biological process this GO :0060445 and branching involved in salivary gland morphogenesis and biological process this GO :0060447 and bud outgrowth involved in lung branching and biological process this GO :0060449 and bud elongation involved in lung branching and biological process this GO :0060496 and mesenchymal-epithelial cell signaling involved in lung development and biological process this GO :0060510 and Type II pneumocyte differentiation and biological process this GO :0060513 and prostatic bud formation and biological process this GO :0060541 and respiratory system development and biological process this GO :0060594 and mammary gland specification and biological process this GO :0060595 and fibroblast growth factor receptor signaling pathway involved in mammary gland specification and biological process this GO :0060615 and mammary gland bud formation and biological process this GO :0060661 and submandibular salivary gland formation and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060665 and regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling and biological process this GO :0060667 and branch elongation involved in salivary gland morphogenesis and biological process this GO :0060879 and semicircular canal fusion and biological process this GO :0060915 and mesenchymal cell differentiation involved in lung development and biological process this GO :0061033 and secretion by lung epithelial cell involved in lung growth and biological process this GO :0061115 and lung proximal/distal axis specification and biological process this GO :0070075 and tear secretion and biological process this GO :0070352 and positive regulation of white fat cell proliferation and biological process this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070384 and Harderian gland development and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process this GO :0071338 and positive regulation of hair follicle cell proliferation and biological process this GO :0090263 and positive regulation of canonical Wnt signaling pathway and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, FGF10 and IDBG-19873 and ENSG00000070193 and 2255, Fgf10 and IDBG-184666 and ENSMUSG00000021732 and 14165, chemoattractant activity, nuclei, this GO :0000132 and establishment of mitotic spindle orientation and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001525 and angiogenesis and biological process this GO :0001656 and metanephros development and biological process this GO :0001759 and organ induction and biological process this GO :0001823 and mesonephros development and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0003338 and metanephros morphogenesis and biological process this GO :0005104 and fibroblast growth factor receptor binding and molecular function this GO :0005111 and type 2 fibroblast growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006935 and chemotaxis and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007368 and determination of left/right symmetry and biological process this GO :0007431 and salivary gland development and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0008544 and epidermis development and biological process this GO :0008589 and regulation of smoothened signaling pathway and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009986 and cell surface and cellular component this GO :0010468 and regulation of gene expression and biological process this GO :0010631 and epithelial cell migration and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010838 and positive regulation of keratinocyte proliferation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030154 and cell differentiation and biological process this GO :0030177 and positive regulation of Wnt signaling pathway and biological process this GO :0030324 and lung development and biological process this GO :0030538 and embryonic genitalia morphogenesis and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0030878 and thyroid gland development and biological process this GO :0030916 and otic vesicle formation and biological process this GO :0030949 and positive regulation of vascular endothelial growth factor receptor signaling pathway and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031016 and pancreas development and biological process this GO :0031069 and hair follicle morphogenesis and biological process this GO :0031076 and embryonic camera-type eye development and biological process this GO :0031532 and actin cytoskeleton reorganization and biological process this GO :0031659 and positive regulation of cyclin-dependent protein kinase activity involved in G1/S and biological process this GO :0032355 and response to estradiol and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032781 and positive regulation of ATPase activity and biological process this GO :0032808 and lacrimal gland development and biological process this GO :0032925 and regulation of activin receptor signaling pathway and biological process this GO :0034394 and protein localization to cell surface and biological process this GO :0035019 and somatic stem cell maintenance and biological process this GO :0035108 and limb morphogenesis and biological process this GO :0035265 and organ growth and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042060 and wound healing and biological process this GO :0042246 and tissue regeneration and biological process this GO :0042472 and inner ear morphogenesis and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042693 and muscle cell fate commitment and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043616 and keratinocyte proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0045596 and negative regulation of cell differentiation and biological process this GO :0045739 and positive regulation of DNA repair and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045747 and positive regulation of Notch signaling pathway and biological process this GO :0045893 and positive regulation of transcription, this GO :0005104 : fibroblast growth factor receptor binding, this GO :0005104 : fibroblast growth factor receptor binding and also this GO :0005111 : type 2 fibroblast growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding and also this GO :0042056 : chemoattractant activity, this GO :0005111 : type 2 fibroblast growth factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, this GO :0042056 : chemoattractant activity, fibroblast growth factor 10
Identity: 3666
Gene: FGF10 | More about : FGF10
Long gene name: fibroblast growth factor 10
Locus: 5p12
Discovery year: 1996-12-16
Entrez gene record: 2255
Pubmed identfication: 9287324
RefSeq identity: NM_004465
Havana BLAST/BLAT: OTTHUMG00000131153

Related Products :

MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
CR11 Recombinant Human Fibroblast growth factor 10, FGF10 10 µg 156 € novo human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
GENTAUR-58bcf447ee22d Human Fibroblast growth factor 10 (FGF10) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bcf4483b3e6 Human Fibroblast growth factor 10 (FGF10) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bcf4488b350 Human Fibroblast growth factor 10 (FGF10) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bcf448d7cab Human Fibroblast growth factor 10 (FGF10) 1000ug 2056 € MBS Recombinant Proteins human
DL-FGF10-Hu Human Fibroblast Growth Factor 10 FGF10 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdc703cdb40 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdccd803c02 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdccd86a209 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcd39eb8a4 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcd3a3d2b3 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd2f2c6a18 Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd658c3eac Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc6f6a3af Anti- Fibroblast Growth Factor 10 (FGF10) Antibody 100ug 580 € MBS Polyclonals human
abx576158 Anti-Rat Fibroblast Growth Factor 10 (FGF10) ELISA Kit 96 tests 731 € abbex rat
EKU04127 Fibroblast Growth Factor 10 (FGF10) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU04128 Fibroblast Growth Factor 10 (FGF10) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU04129 Fibroblast Growth Factor 10 (FGF10) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
GENTAUR-58bb7cbbc7560 Mouse Fibroblast growth factor 10 (Fgf10) 100ug 1553 € MBS Recombinant Proteins mouse
GENTAUR-58bb7cbc247b1 Mouse Fibroblast growth factor 10 (Fgf10) 1000ug 1553 € MBS Recombinant Proteins mouse
GENTAUR-58bb7cbc7337f Mouse Fibroblast growth factor 10 (Fgf10) 100ug 2056 € MBS Recombinant Proteins mouse
GENTAUR-58bb7cbcc9e86 Mouse Fibroblast growth factor 10 (Fgf10) 1000ug 2056 € MBS Recombinant Proteins mouse
DL-FGF10-Mu Mouse Fibroblast Growth Factor 10 FGF10 ELISA Kit 96T 788 € DL elisas mouse
DL-FGF10-Ra Rat Fibroblast Growth Factor 10 FGF10 ELISA Kit 96T 846 € DL elisas rat
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human