Recombinant Human Calcitonin, CALCA (C-6His, E. coli)

Contact us
Catalog number: CG52
Price: 529 €
Supplier: acr
Product name: Recombinant Human Calcitonin, CALCA (C-6His, E. coli)
Quantity: 0,1 ml
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Calcitonin is produced by our E, coli expression system and the target gene encoding Tyr58-Asn141 is expressed with a 6His tag at the C-terminus
Molecular Weight: 10, 5 kD
UniProt number: P01258
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, 50% Glycerol, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CALCA (C-6His, Calcitonin
Short name: CALCA (C-6His, E, coli), Recombinant Calcitonin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: E, calcitonin-related polypeptide a (C-6His, coli), sapiens Calcitonin, recombinant H
Alternative technique: rec
Alternative to gene target: CALC1 and CGRP and CGRP-I and CGRP1 and CT and KC, CALCA and IDBG-33289 and ENSG00000110680 and 796, CALCA and IDBG-632774 and ENSBTAG00000047380 and 514876, Calca and IDBG-207270 and ENSMUSG00000030669 and 12310, DNA-templated and biological process this GO :0045909 and positive regulation of vasodilation and biological process this GO :0045986 and negative regulation of smooth muscle contraction and biological process this GO :0048265 and response to pain and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050965 and detection of temperature stimulus involved in sensory perception of pain and biological process this GO :0051480 and cytosolic calcium ion homeostasis and biological process this GO :0051482 and positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :1990090 and cellular response to nerve growth factor stimulus and biological process, identical protein binding, nuclei, this GO :0001935 and endothelial cell proliferation and biological process this GO :0001944 and vasculature development and biological process this GO :0001976 and neurological system process involved in regulation of systemic arterial blood pressure and biological process this GO :0001984 and vasodilation of artery involved in baroreceptor response to increased systemic arterial blood pressure and biological process this GO :0002027 and regulation of heart rate and biological process this GO :0002031 and G-protein coupled receptor internalization and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0007189 and adenylate cyclase-activating G-protein coupled receptor signaling pathway and biological process this GO :0007190 and activation of adenylate cyclase activity and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007218 and neuropeptide signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007631 and feeding behavior and biological process this GO :0008016 and regulation of heart contraction and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0009408 and response to heat and biological process this GO :0010523 and negative regulation of calcium ion transport into cytosol and biological process this GO :0030279 and negative regulation of ossification and biological process this GO :0030424 and axon and cellular component this GO :0030819 and positive regulation of cAMP biosynthetic process and biological process this GO :0031623 and receptor internalization and biological process this GO :0031645 and negative regulation of neurological system process and biological process this GO :0031716 and calcitonin receptor binding and molecular function this GO :0032147 and activation of protein kinase activity and biological process this GO :0032403 and protein complex binding and molecular function this GO :0032730 and positive regulation of interleukin-1 alpha production and biological process this GO :0032757 and positive regulation of interleukin-8 production and biological process this GO :0042311 and vasodilation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043195 and terminal bouton and cellular component this GO :0043542 and endothelial cell migration and biological process this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0045762 and positive regulation of adenylate cyclase activity and biological process this GO :0045776 and negative regulation of blood pressure and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045779 and negative regulation of bone resorption and biological process this GO :0045892 and negative regulation of transcription, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0031716 : calcitonin receptor binding and also this GO :0032403 : protein complex binding and also this GO :0042802 : identical protein binding, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0031716 : calcitonin receptor binding, this GO :0032403 : protein complex binding, this GO :0042802 : identical protein binding, calcitonin-related polypeptide alpha
Identity: 1437
Gene: CALCA | More about : CALCA
Long gene name: calcitonin related polypeptide alpha
Synonyms gene: CALC1
Synonyms gene name: calcitonin 1
Synonyms name: calcitonin
Locus: 11p15, 2
Discovery year: 1986-01-01
GenBank acession: X00356 M64486
Entrez gene record: 796
Pubmed identfication: 6546550
RefSeq identity: NM_001741
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000159731
Locus Specific Databases: LRG_13

Related Products :

CG52 Recombinant Human Calcitonin, CALCA (C-6His, E. coli) 1 mg 2283 € novo e-coli
CA21 Recombinant Human Calcitonin, CALCA (C-6His) 50 µg 496 € novo human
GWB-460908 Calcitonin/Calcitonin-Related Poly peptide sequence Alpha (CALCA) Rabbit antibody to or anti-Human Polyclonal (aa1-32) antibody 1 x 1 vial 648 € genways human
AE52610HO-48 ELISA test for Horse calcitonin-related polypeptide alpha (CALCA) 1x plate of 48 wells 402 € abebio horse
AE52610HO-96 Horse calcitonin-related polypeptide alpha (CALCA) ELISA Kit 1x plate of 96 wells 671 € abebio horse
LV105700 CALCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV105701 CALCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV105702 CALCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV105703 CALCA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV105705 CALCA Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV105704 CALCA Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
AP50123HU-100ug Human CALCA Protein 0.1mg 184 € abebio human
AP50123HU-1mg Human CALCA Protein 1mg 604 € abebio human
GENTAUR-58bdecb8088a6 Anti- CALCA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdecb85b4aa Anti- CALCA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdee3ca132f Anti- CALCA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdee3d113ba Anti- CALCA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf61ddb377 Anti- CALCA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf61e40f22 Anti- CALCA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf838d5519 Anti- CALCA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf8393171d Anti- CALCA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be073e01620 Anti- CALCA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be073e59e08 Anti- CALCA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be452be6a60 Anti- CALCA Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be57e028e48 Anti- CALCA Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be57e08a976 Anti- CALCA Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be57e0d4d76 Anti- CALCA Antibody 100ug 387 € MBS Polyclonals human
AP33515SU-N anti-CGRP / CALCA Antibody 50 Вµl 833 € acr human
BA101 anti-CGRP / CALCA Antibody 50 Вµg 355 € acr human
BP022 anti-CGRP / CALCA Antibody 0,1 ml 529 € acr human