| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Calcitonin is produced by our E, coli expression system and the target gene encoding Tyr58-Asn141 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
10, 5 kD |
| UniProt number: |
P01258 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, 50% Glycerol, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CALCA (C-6His, Calcitonin |
| Short name: |
CALCA (C-6His, E, coli), Recombinant Calcitonin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Escherichia coli |
| Species: |
E, Humans, coli, coli, E |
| Alternative name: |
E, calcitonin-related polypeptide a (C-6His, coli), sapiens Calcitonin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CALC1 and CGRP and CGRP-I and CGRP1 and CT and KC, CALCA and IDBG-33289 and ENSG00000110680 and 796, CALCA and IDBG-632774 and ENSBTAG00000047380 and 514876, Calca and IDBG-207270 and ENSMUSG00000030669 and 12310, DNA-templated and biological process this GO :0045909 and positive regulation of vasodilation and biological process this GO :0045986 and negative regulation of smooth muscle contraction and biological process this GO :0048265 and response to pain and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050965 and detection of temperature stimulus involved in sensory perception of pain and biological process this GO :0051480 and cytosolic calcium ion homeostasis and biological process this GO :0051482 and positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :1990090 and cellular response to nerve growth factor stimulus and biological process, identical protein binding, nuclei, this GO :0001935 and endothelial cell proliferation and biological process this GO :0001944 and vasculature development and biological process this GO :0001976 and neurological system process involved in regulation of systemic arterial blood pressure and biological process this GO :0001984 and vasodilation of artery involved in baroreceptor response to increased systemic arterial blood pressure and biological process this GO :0002027 and regulation of heart rate and biological process this GO :0002031 and G-protein coupled receptor internalization and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007159 and leukocyte cell-cell adhesion and biological process this GO :0007189 and adenylate cyclase-activating G-protein coupled receptor signaling pathway and biological process this GO :0007190 and activation of adenylate cyclase activity and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007218 and neuropeptide signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007631 and feeding behavior and biological process this GO :0008016 and regulation of heart contraction and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0009408 and response to heat and biological process this GO :0010523 and negative regulation of calcium ion transport into cytosol and biological process this GO :0030279 and negative regulation of ossification and biological process this GO :0030424 and axon and cellular component this GO :0030819 and positive regulation of cAMP biosynthetic process and biological process this GO :0031623 and receptor internalization and biological process this GO :0031645 and negative regulation of neurological system process and biological process this GO :0031716 and calcitonin receptor binding and molecular function this GO :0032147 and activation of protein kinase activity and biological process this GO :0032403 and protein complex binding and molecular function this GO :0032730 and positive regulation of interleukin-1 alpha production and biological process this GO :0032757 and positive regulation of interleukin-8 production and biological process this GO :0042311 and vasodilation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043195 and terminal bouton and cellular component this GO :0043542 and endothelial cell migration and biological process this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0045762 and positive regulation of adenylate cyclase activity and biological process this GO :0045776 and negative regulation of blood pressure and biological process this GO :0045778 and positive regulation of ossification and biological process this GO :0045779 and negative regulation of bone resorption and biological process this GO :0045892 and negative regulation of transcription, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0031716 : calcitonin receptor binding and also this GO :0032403 : protein complex binding and also this GO :0042802 : identical protein binding, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0031716 : calcitonin receptor binding, this GO :0032403 : protein complex binding, this GO :0042802 : identical protein binding, calcitonin-related polypeptide alpha |
| Identity: |
1437 |
| Gene: |
CALCA |
More about : CALCA |
| Long gene name: |
calcitonin related polypeptide alpha |
| Synonyms gene: |
CALC1 |
| Synonyms gene name: |
calcitonin 1 |
| Synonyms name: |
calcitonin |
| Locus: |
11p15, 2 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
X00356 M64486 |
| Entrez gene record: |
796 |
| Pubmed identfication: |
6546550 |
| RefSeq identity: |
NM_001741 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000159731 |
| Locus Specific Databases: |
LRG_13 |