Recombinant Human Galectin-3, LGALS3 (E. coli)

Contact us
Catalog number: C068
Price: 943 €
Supplier: novo
Product name: Recombinant Human Galectin-3, LGALS3 (E. coli)
Quantity: 1 mg
Other quantities: 10 µg 100€ 50 µg 192€ 500 µg 674€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-3 is produced by our E, coli expression system and the target gene encoding Ala2-Ile250 is expressed
Molecular Weight: 26 kD
UniProt number: P17931
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 mM DTT, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH 7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LGALS3, Galectin-3
Short name: LGALS3 (E, coli), Recombinant Galectin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: E, Humans, coli, coli, E
Alternative name: LGALS3 (E, coli), sapiens Galectin-3, recombinant H
Alternative technique: rec
Identity: 6563
Gene: LGALS3 | More about : LGALS3
Long gene name: galectin 3
Synonyms gene: LGALS2
Synonyms gene name: 3 , galactoside-binding, lectin, soluble
Synonyms: MAC-2 GALIG
Synonyms name: advanced glycation end-product receptor 3
Locus: 14q22, 3
Discovery year: 1991-09-13
GenBank acession: M64303
Entrez gene record: 3958
Pubmed identfication: 2009535 8063692
RefSeq identity: NM_002306
Classification: Endogenous ligands Galectins
Havana BLAST/BLAT: OTTHUMG00000171030

Related Products :

https://antibody-antibodies.com/ | https://gentaur.com/ | https://gen-script.com/ | https://diagenox.com/ | https://clonagen.com/ | http://gentaursearch.com/ | http://gentaurpub.com/ | https://gentaur-online.com/ | http://anti-anti-pdf.com/ | http://gentaur-worldwide.com/