FOXA3 Antibody

Contact us
Catalog number: R32147
Price: 406 €
Supplier: NJS poly
Product name: FOXA3 Antibody
Quantity: 0.1mg
Other quantities: 1 tube 486€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: FOXA3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the FOXA3 antibody should be determined by the researcher
Intented use: This FOXA3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P55318
Purity: Antigen affinity
Description: HNF-3G is a member of the forkhead class of DNA-binding proteins, Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver, The crystal structure of a similar protein in rat has been resolved, These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, This gene is mapped to 19q13, also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), and they also interact with chromatin, is a protein that in humans is encoded by the FOXA3 gene, 32, Hepatocyte nuclear factor 3-gamma (HNF-3G)
Immunogen: Amino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FOXA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: FOXA3
Short name: FOXA3 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: FOXA3 (Antibody to)
Alternative technique: antibodies
Identity: 5023
Gene: FOXA3 | More about : FOXA3
Long gene name: forkhead box A3
Synonyms gene: HNF3G
Synonyms gene name: gamma , hepatocyte nuclear factor 3
Locus: 19q13, 32
Discovery year: 1998-02-11
GenBank acession: L12141
Entrez gene record: 3171
Pubmed identfication: 9119385
Classification: Forkhead boxes
Havana BLAST/BLAT: OTTHUMG00000182484

Related Products :